The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|904744.3.peg.1557: Staphylococcus aureus subsp. aureus 21259

This feature in The SEED Viewer

NCBI Taxonomy Id: 904744

Current Assignment: Cysteine desulfurase (EC 2.8.1.7)
Translate Function Assignments



Context on contig AFTS01000022 from base 65555 to 76680 (11126 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1552 66757 65555 1203 -       2: 2 4   Acetate kinase (EC 2.7.2.1) gene_name|ackA, locus|SA21259_1569, protein_id|EGS87222.1, gi|341846024
1553 67792 66845 948 - 87     1: 6   Adenine-specific methyltransferase (EC 2.1.1.72) locus|SA21259_1570, protein_id|EGS87197.1, gi|341845999
1554 68409 67915 495 - 122         Thiol peroxidase, Tpx-type (EC 1.11.1.15) locus|SA21259_1571, protein_id|EGS87344.1, gi|341846146
1555 69277 68507 771 - 97         Putative membrane protein YfcA locus|SA21259_1572, protein_id|EGS87180.1, gi|341845982
1556 70544 69321 1224 - 43 14 2: 5 1   tRNA S(4)U 4-thiouridine synthase (former ThiI) gene_name|thiI, locus|SA21259_1573, protein_id|EGS87227.1, gi|341846029
1557 71710 70544 1167 - -1   1: 3   Cysteine desulfurase (EC 2.8.1.7) locus|SA21259_1574, protein_id|EGS87187.1, gi|341845989
1558 71847 71981 135 + 136         FIG01108306: hypothetical protein locus|SA21259_1575, protein_id|EGS87168.1, gi|341845970
1559 73749 72055 1695 - 73 5     Septation ring formation regulator EzrA gene_name|ezrA, locus|SA21259_1576, protein_id|EGS87260.1, gi|341846062
1560 73886 74350 465 + 136 4     Free methionine-(R)-sulfoxide reductase, contains GAF domain locus|SA21259_1577, protein_id|EGS87333.1, gi|341846135
1561 74594 75196 603 + 243         SSU ribosomal protein S4p (S9e) gene_name|rpsD, locus|SA21259_1578, protein_id|EGS87282.1, gi|341846084
1562 76154 75411 744 - 214         Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46) locus|SA21259_1579, protein_id|EGS87179.1, gi|341845981
1563 76234 76680 447 + 79         Organic hydroperoxide resistance protein locus|SA21259_1580, protein_id|EGS87329.1, gi|341846131

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
DNA/RNA_S_modification Cysteine desulfurase (EC 2.8.1.7)


  Protein Sequence

>fig|904744.3.peg.1557 Cysteine desulfurase (EC 2.8.1.7)
MINEREVFILIYLDNAATTKAFEEVLDTYLKVNQSMYYNPNSPHKAGLQANQLLQQAKAQ
INAMINSKTNYDVVFTSGATESNNLALKGIAYRKFDTAKEIITSVLEHPSVLEVVRYLEA
HEGFKVKYVDVKKDGSINLEHFKELMSDKVGLVTCMYVNNVTGQIQPIPQMAKVIKNYPK
AHFHVDAVQAFGKISMDLNNVDSISLSGHKFNGLKGQGVLLVNHIQNVEPTVHGGGQEYG
VRSGTVNLPNDIAMVKAMKIANENFEALNAFVTELNNDVRQFLNKYHGVYINSSTSGSPF
VLNISFPGVKGEVLVNAFSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSF
GATTTKEDIARFKEIFIIIYEEIKELLK

MD5 = 52d8974a516e182d6ff4171bcfbdfa7c


  DNA Sequence

>fig|904744.3.peg.1557 Cysteine desulfurase (EC 2.8.1.7)
atgattaatgaaagagaagtgtttattttgatatatctagataatgcggcaacgacgaaa
gcatttgaagaagtgttagatacttatttaaaagtaaatcaatcaatgtattataatccg
aatagtccgcataaagctggtttgcaggcaaatcaattactacaacaagcaaaagcccaa
attaatgcaatgattaattcaaaaacaaattatgatgttgtattcactagtggtgcaact
gaatccaataatcttgctttaaaaggtattgcctatcgtaaatttgatacagcgaaggaa
ataattacatccgtgttagagcatccgtccgtattagaggttgtaagatatttggaagca
cacgaaggatttaaagttaaatatgttgatgtaaagaaagatggcagtattaacttagaa
cacttcaaagaattaatgtcagacaaagtcggtttagtaacatgtatgtatgtaaataat
gtaactggacaaatacagcctattccacaaatggctaaagttataaaaaattatcctaag
gcacattttcatgtagatgcggttcaagcattcggcaaaatttcaatggatctcaataac
gtagatagtattagtttaagtggacataagtttaatggtttaaaaggtcaaggcgtctta
cttgtaaatcacattcaaaatgttgaacctactgtccatggtggtggtcaagaatatggc
gttagaagtggaacagttaatttgccaaatgatattgcaatggttaaagcgatgaagata
gctaatgaaaactttgaagcattgaatgcatttgttactgagttaaataatgacgtccgt
caatttttaaataaatatcatggagtttatattaattcttcaacttcaggttcaccattc
gttttaaatattagttttcctggcgtaaaaggtgaagtattagttaatgctttttcaaaa
tatgacattatgatatctacgacgagtgcttgttcatctaaacgtaataaattaaatgaa
gtattggctgcaatgggattatcagacaaatctattgaaggtagtataagattatcattt
ggggctactacaactaaagaagatatagcaaggtttaaagaaatatttatcatcatttat
gaggaaattaaggagttgctaaaataa


  DNA with Flanking Sequence

>fig|904744.3.peg.1557 Cysteine desulfurase (EC 2.8.1.7)
aaggactatagcaatgttgataagagcttaaatgaagctgaacgattatttaaaaataat
cgctataagcgtgcgattgaaattgcagagcaagctcttgaaagtgttgagccaggtgtc
actaaacatattgaagaagaagttattaagcaatagaaactagtatgtagttatacttaa
ataatatgagcactctgtcaaattggactgatgagtttaataattgaagttagccaacga
tacgttgtctagcttcttttttatatggataaatgaaagggacaataaatataaatagca
attgtttaaagataaacgtaatcaaatgtgttgttttaattaatataagtagtgaaaaaa
gcataatcacacagctgtttaaatagagtgaaatagtctaattcttatttaataagtaga
aataagattattttgcgctataacctttattttttgtcggataatagtataatgcttgag
taaaacaattttaacgattgatgattaatgaaagagaagtgtttattttgatatatctag
ataatgcggcaacgacgaaagcatttgaagaagtgttagatacttatttaaaagtaaatc
aatcaatgtattataatccgaatagtccgcataaagctggtttgcaggcaaatcaattac
tacaacaagcaaaagcccaaattaatgcaatgattaattcaaaaacaaattatgatgttg
tattcactagtggtgcaactgaatccaataatcttgctttaaaaggtattgcctatcgta
aatttgatacagcgaaggaaataattacatccgtgttagagcatccgtccgtattagagg
ttgtaagatatttggaagcacacgaaggatttaaagttaaatatgttgatgtaaagaaag
atggcagtattaacttagaacacttcaaagaattaatgtcagacaaagtcggtttagtaa
catgtatgtatgtaaataatgtaactggacaaatacagcctattccacaaatggctaaag
ttataaaaaattatcctaaggcacattttcatgtagatgcggttcaagcattcggcaaaa
tttcaatggatctcaataacgtagatagtattagtttaagtggacataagtttaatggtt
taaaaggtcaaggcgtcttacttgtaaatcacattcaaaatgttgaacctactgtccatg
gtggtggtcaagaatatggcgttagaagtggaacagttaatttgccaaatgatattgcaa
tggttaaagcgatgaagatagctaatgaaaactttgaagcattgaatgcatttgttactg
agttaaataatgacgtccgtcaatttttaaataaatatcatggagtttatattaattctt
caacttcaggttcaccattcgttttaaatattagttttcctggcgtaaaaggtgaagtat
tagttaatgctttttcaaaatatgacattatgatatctacgacgagtgcttgttcatcta
aacgtaataaattaaatgaagtattggctgcaatgggattatcagacaaatctattgaag
gtagtataagattatcatttggggctactacaactaaagaagatatagcaaggtttaaag
aaatatttatcatcatttatgaggaaattaaggagttgctaaaataatgaagtatgatca
cttgcttgttagatacggggagttaacattaaagggttcaaatagaaaaaaatttgtaaa
tcaattaagaaataatgtaaataagtcattaaaaggacttgatgggtttgtcgttaaagg
caaacgagatcgtatgtatattgaacttgaagaccatgcagatataaatgaaataacata
tcgattatcaaaaattttcggtattaaatctattagtccagtattaaaagtagaaaaaac
aatagaggcaatgagtgcagcggcaattaaatttgcgcagcaatttgaagaaaacagcac
atttaaaattgatgtgaagcgtgccgataaaaatttcccaatggatacgtatgaattaca
gcgtgaattgggtggtgctgtattgaagcacttcgacaatatttctgttaatgtcaaacg
tccagatcatgaaattcgagtggaagttagattagatgcaatttatatgtatgaagaagt
tgttccg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
14 fig|904744.3.peg.1556 tRNA S(4)U 4-thiouridine synthase (former ThiI)
5 fig|904744.3.peg.1559 Septation ring formation regulator EzrA
4 fig|904744.3.peg.1560 Free methionine-(R)-sulfoxide reductase, contains GAF domain


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search