The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|904319.3.peg.1166: Staphylococcus epidermidis VCU037

This feature in The SEED Viewer

NCBI Taxonomy Id: 904319

Current Assignment: putative membrane protein
Translate Function Assignments



Context on contig AFTY01000028 from base 9 to 8851 (8843 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1164 521 9 513 -           hypothetical protein locus|SEVCU037_1590, protein_id|EGS77132.1, gi|341653363
1165 2119 818 1302 - 296     1: 1   Methionine transporter MetT locus|SEVCU037_1591, protein_id|EGS77239.1, gi|341653470
1166 3012 2425 588 - 305         putative membrane protein locus|SEVCU037_1593, protein_id|EGS77153.1, gi|341653384
1167 3667 3056 612 - 43         Flavin reductase-like, FMN-binding locus|SEVCU037_1594, protein_id|EGS77240.1, gi|341653471
1168 4835 3954 882 - 286     1: 2   Oxidoreductase, short-chain dehydrogenase/reductase family locus|SEVCU037_1595, protein_id|EGS77205.1, gi|341653436
1169 6050 4932 1119 - 96         N-acetyl-L,L-diaminopimelate deacetylase homolog locus|SEVCU037_1596, protein_id|EGS77234.1, gi|341653465
1170 7455 6520 936 - 469     1: 3   Formiminoglutamase (EC 3.5.3.8) gene_name|hutG, locus|SEVCU037_1597, protein_id|EGS77212.1, gi|341653443
1171 7703 8851 1149 + 247         FIG01108370: hypothetical protein locus|SEVCU037_1598, protein_id|EGS77131.1, gi|341653362

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|904319.3.peg.1166 putative membrane protein
MKAYLYKFMPLLIFVIGLIIFYVFNDYPTLIHVIVIIAFITNGLKNVYFVNNNIRNHMIW
VSPKLDRILGMISGILYFGIYVVGFIKQQPLWIVMLILVSTVGTAVLLETKLHITSLQLE
ETLSSERIKRKVISRHKAQRLKCIFFTVIVVVIISMLISLYLKLMVIFGLAVTIFILASI
SVAIFEKYFTIIENM

MD5 = 47bb930c4e91346cc273bba0a0f29e42


  DNA Sequence

>fig|904319.3.peg.1166 putative membrane protein
atgaaagcatatctatataaattcatgccattgctcattttcgtcataggactgattatc
ttttacgtttttaatgattatcccacattgatacatgtcatagtgattattgcttttata
acgaatggattgaaaaatgtatattttgttaataataatattagaaatcatatgatatgg
gtgagccctaaactcgatcgtatccttggtatgatttcgggcatactatattttggtatt
tacgtggttggctttataaagcaacagcctttatggatagtgatgcttattctagtatca
acagtgggtactgcggttttattagaaacaaaattacatattacatcacttcaattagag
gagacgttatcatctgaacggataaaacgtaaagtaatatcaagacataaagcacaacgt
cttaagtgtatattttttactgtgattgttgtagtaatcatttcaatgctcatatcatta
tatttaaagttgatggttatttttggacttgcagtaacgatttttatcttagcatcaata
agtgtggctattttcgaaaaatactttactattattgaaaatatgtaa


  DNA with Flanking Sequence

>fig|904319.3.peg.1166 putative membrane protein
tacaccacctatgattgcaattgctgttcaacgtacaaagggaaatagaaaagacacctc
aataaatatagaacaatcaggtgagtttgtagtgcatattactgatgaggctattgttaa
tgatgtgaatgaaactgctgccccgttagaatatggtgttaatgaacttaaaagaacctc
tctaagtatgattgattcagatttaattaaagttccagcaatcaaagaagcaaaagtaag
gtttgagtgtaagcttcatcaaatagtacaattgggcaacaaagataacgggagtgattt
gataattggtgaaattgtcgtgtaccatatcgatgaagaagtttattttgaagatagtaa
aattgatgcaaatcaattaaatccggtagctaggttagctggaaatgattactctttgtt
aggtcaaacatttacggttaatcggcctacctcataaaaataaaaatacatatgtaaatc
tcattttaagggtgtcattgatgaaagcatatctatataaattcatgccattgctcattt
tcgtcataggactgattatcttttacgtttttaatgattatcccacattgatacatgtca
tagtgattattgcttttataacgaatggattgaaaaatgtatattttgttaataataata
ttagaaatcatatgatatgggtgagccctaaactcgatcgtatccttggtatgatttcgg
gcatactatattttggtatttacgtggttggctttataaagcaacagcctttatggatag
tgatgcttattctagtatcaacagtgggtactgcggttttattagaaacaaaattacata
ttacatcacttcaattagaggagacgttatcatctgaacggataaaacgtaaagtaatat
caagacataaagcacaacgtcttaagtgtatattttttactgtgattgttgtagtaatca
tttcaatgctcatatcattatatttaaagttgatggttatttttggacttgcagtaacga
tttttatcttagcatcaataagtgtggctattttcgaaaaatactttactattattgaaa
atatgtaaactattattaaaatatttaaaataataagtgttgacgttattgcaaatatct
tgtaacgttaaacacaattcaataacttatcaagagaagtggagggactggcccaaagaa
gcttcggcaacattgtatcatgtgccaattccagtaaccgagaaggttagaagataaggt
taaacacgacgttaactgagactggggcatgattacgtgtcctggttttttatttttgag
ttattgattaaatagataggaattttttagtataaaatctatcaatccattatacgggaa
agtaggttagattatgaaagagatgaagaatggcaatgcttgggcattaattcctttatt
gttatttgtcttactatttctaggtgttggtattatttctggtgattttaccactatgcc
attaaatgttgctattacaattactgttattgttgccttacttatgaaccgcaaggaaac
ttttgcaaaaaaagtagaggtatttaca


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search