The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|868207.3.peg.4387: Escherichia coli DEC15B

This feature in The SEED Viewer

NCBI Taxonomy Id: 868207

Current Assignment: Dihydroxy-acid dehydratase (EC 4.2.1.9)
Translate Function Assignments



Context on contig AIHP01000030 from base 6809 to 18822 (12014 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
4383 8329 6809 1521 -           MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein gene_name|comM, locus|ECDEC15B_4511, protein_id|EHX99867.1, gi|378239890
4384 8919 10565 1647 + 589     1: 1   Acetolactate synthase large subunit (EC 2.2.1.6) locus|ECDEC15B_4512, protein_id|EHX99868.1, gi|378239891
4385 10562 10825 264 + -4     1: 1 dlit(3550695) Acetolactate synthase small subunit (EC 2.2.1.6) gene_name|ilvM, locus|ECDEC15B_4513, protein_id|EHX99869.1, gi|378239892
4386 10845 11774 930 + 19     3: 4 1 2 dlit(9163511)
dlit(3550695)
dlit(3897211)
dlit(3069843)
Branched-chain amino acid aminotransferase (EC 2.6.1.42) gene_name|ilvE, locus|ECDEC15B_4514, protein_id|EHX99870.1, gi|378239893
4387 11839 13689 1851 + 64     1: 1   Dihydroxy-acid dehydratase (EC 4.2.1.9) gene_name|ilvD, locus|ECDEC15B_4515, protein_id|EHX99871.1, gi|378239894
4388 13692 15236 1545 + 2     1: 1   Threonine dehydratase biosynthetic (EC 4.3.1.19) gene_name|ilvA, locus|ECDEC15B_4516, protein_id|EHX99872.1, gi|378239895
4389 16181 15288 894 - 51         HTH-type transcriptional regulator IlvY locus|ECDEC15B_4517, protein_id|EHX99873.1, gi|378239896
4390 16331 17806 1476 + 149     2: 1 3   Ketol-acid reductoisomerase (EC 1.1.1.86) gene_name|ilvC, locus|ECDEC15B_4518, protein_id|EHX99874.1, gi|378239897
4391 18174 17893 282 - 86       dlit(8163020) Peptidyl-prolyl cis-trans isomerase PpiC (EC 5.2.1.8) locus|ECDEC15B_4519, protein_id|EHX99875.1, gi|378239898
4392 18822 18373 450 - 198         FIG00642180: hypothetical protein locus|ECDEC15B_4520, protein_id|EHX99876.1, gi|378239899

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user Dihydroxy-acid dehydratase (EC 4.2.1.9)


  Protein Sequence

>fig|868207.3.peg.4387 Dihydroxy-acid dehydratase (EC 4.2.1.9)
MPKYRSATTTHGRNMAGARALWRATGMTDADFGKPIIAVVNSFTQFVPGHVHLRDLGKLV
AEQIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSVEYMVNAHCADAMVCIS
NCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKLSDQIIKLDLVDAMIQGADPKVSDSQ
SDQVERSACPTCGSCSGMFTANSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIV
ELTKRYYEQNDESALPRNIASKAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEIDFTMSD
IDKLSRKVPQLCKVAPSTQKYHMEDVHRAGGVIGILGELDRAGLLNRDVKNVLGLTLPQT
LEQYDVMLTQDDAVKNMFRAGPAGIRTTQAFSQDCRWDSLDDDRANGCIRSLEHAYSKDG
GLAVLYGNFAENGCIVKTAGVDDSILKFTGPAKVYESQDDAVEAILGGKVVAGDVVVIRY
EGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASGGSIGL
IEDGDLIAIDIPNRGIQLQVSDAELAARREAQEARGDKAWTPKNRERQVSFALRAYASLA
TSADKGAVRDKSKLGG

MD5 = ee4606fd9ece2c27c6a7449be8599eac


  DNA Sequence

>fig|868207.3.peg.4387 Dihydroxy-acid dehydratase (EC 4.2.1.9)
atgcctaagtaccgttccgccaccaccactcatggtcgtaatatggcgggtgctcgtgcg
ctgtggcgcgccaccggaatgaccgacgccgatttcggtaagccgattatcgcggttgtg
aactcgttcacccaatttgtaccgggtcacgtccatctgcgcgatctcggtaaactggtc
gccgaacaaattgaagcggctggcggcgttgccaaagagttcaacaccattgcggtggat
gatgggattgccatgggccacggggggatgctttattcactgccatctcgcgaactgatc
gctgattccgttgagtatatggtcaacgcccactgcgccgacgccatggtctgcatctct
aactgcgacaaaatcaccccggggatgctgatggcttccctgcgcctgaatattccggtg
atctttgtttccggcggcccgatggaggccgggaaaaccaaactgtccgatcagataatc
aaactcgatctggttgatgcgatgatccagggcgcagacccgaaagtttctgactcccag
agcgatcaggttgaacgttccgcctgcccaacctgcggttcctgctccgggatgtttacc
gctaactcaatgaactgcctgaccgaagcgctgggcctgtcgcagccgggcaacggctcg
ctgctggcaacccacgccgaccgtaagcagctgttccttaatgctggtaaacgcattgtt
gaattgaccaaacgttattacgagcaaaacgacgaaagtgcactgccgcgtaatatcgcc
agtaaggcggcgtttgaaaacgccatgacgctggatatcgcgatgggtggatcgactaac
accgtacttcacctgctggcggcggcgcaggaagcggaaatcgacttcaccatgagtgat
atcgataagctttcccgcaaggttccacagctgtgtaaagttgcgccgagcacccagaaa
taccatatggaagatgttcaccgtgctggtggtgttatcggtattctcggcgaactggat
cgcgcggggttactgaaccgtgatgtgaaaaacgtacttggcctgacgttgccgcaaacg
ctggaacaatacgacgttatgctgacccaggatgacgcggtaaaaaatatgttccgcgcc
ggccctgcgggtattcgtaccacacaggcattctcgcaggattgccgttgggattctctc
gatgacgatcgcgccaatggctgtatccgctcgctggaacacgcctacagcaaagacggc
ggcctggcggtgctctacggtaatttcgcagaaaacggctgcatcgttaaaaccgcgggc
gtcgatgacagcatcctcaaattcaccggcccggcgaaagtgtacgaaagccaggacgac
gcggtagaagcgatcctcggtggcaaagttgtcgcgggcgatgtggtggtgatccgctat
gaaggcccgaaaggcggccctggcatgcaggaaatgctctacccaaccagcttcctgaaa
tcaatgggtctcggtaaagcctgtgcgctgatcaccgacggtcgtttctctggcggcacc
tctggtctttccatcggccacgtctcaccggaagcggcaagcggcggcagcattggcctg
attgaagatggtgacctgatcgctatcgacatcccgaaccgtggcattcagttacaggta
agcgatgccgaactggcggcgcgtcgtgaagcgcaggaagctcggggtgacaaagcctgg
acgccgaaaaaccgtgaacgtcaggtttcctttgccctgcgtgcctacgccagcctggcg
accagcgccgacaaaggtgcggtgcgcgataaatcgaaactggggggttaa


  DNA with Flanking Sequence

>fig|868207.3.peg.4387 Dihydroxy-acid dehydratase (EC 4.2.1.9)
cctctcttccctgctggtgggtagcgaagcgcgccgccacggttatcaggaaggtatcgc
gctggatgtgaacggttatatctctgaaggcgcaggcgaaaacctgtttgaagtgaaaga
tggtgtgctgttcaccccaccgttcacctcctccgcgctgccgggtattacccgtgatgc
catcatcaaactggcgaaagagctgggaattgaagtacgtgagcaggtgctgtcgcgcga
atccctgtacctggcggatgaagtgtttatgtccggtacggcggcagaaatcacgccagt
gcgcagcgtagacggtattcaggttggcgaaggccgttgtggcccggttaccaaacgcat
tcagcaagccttcttcggcctcttcactggcgaaaccgaagataaatggggctggttaga
tcaagttaatcaataaatacaaaaaatgggacggcacgcaccgtcccatttacgagacag
acactgggagtaaataaagtatgcctaagtaccgttccgccaccaccactcatggtcgta
atatggcgggtgctcgtgcgctgtggcgcgccaccggaatgaccgacgccgatttcggta
agccgattatcgcggttgtgaactcgttcacccaatttgtaccgggtcacgtccatctgc
gcgatctcggtaaactggtcgccgaacaaattgaagcggctggcggcgttgccaaagagt
tcaacaccattgcggtggatgatgggattgccatgggccacggggggatgctttattcac
tgccatctcgcgaactgatcgctgattccgttgagtatatggtcaacgcccactgcgccg
acgccatggtctgcatctctaactgcgacaaaatcaccccggggatgctgatggcttccc
tgcgcctgaatattccggtgatctttgtttccggcggcccgatggaggccgggaaaacca
aactgtccgatcagataatcaaactcgatctggttgatgcgatgatccagggcgcagacc
cgaaagtttctgactcccagagcgatcaggttgaacgttccgcctgcccaacctgcggtt
cctgctccgggatgtttaccgctaactcaatgaactgcctgaccgaagcgctgggcctgt
cgcagccgggcaacggctcgctgctggcaacccacgccgaccgtaagcagctgttcctta
atgctggtaaacgcattgttgaattgaccaaacgttattacgagcaaaacgacgaaagtg
cactgccgcgtaatatcgccagtaaggcggcgtttgaaaacgccatgacgctggatatcg
cgatgggtggatcgactaacaccgtacttcacctgctggcggcggcgcaggaagcggaaa
tcgacttcaccatgagtgatatcgataagctttcccgcaaggttccacagctgtgtaaag
ttgcgccgagcacccagaaataccatatggaagatgttcaccgtgctggtggtgttatcg
gtattctcggcgaactggatcgcgcggggttactgaaccgtgatgtgaaaaacgtacttg
gcctgacgttgccgcaaacgctggaacaatacgacgttatgctgacccaggatgacgcgg
taaaaaatatgttccgcgccggccctgcgggtattcgtaccacacaggcattctcgcagg
attgccgttgggattctctcgatgacgatcgcgccaatggctgtatccgctcgctggaac
acgcctacagcaaagacggcggcctggcggtgctctacggtaatttcgcagaaaacggct
gcatcgttaaaaccgcgggcgtcgatgacagcatcctcaaattcaccggcccggcgaaag
tgtacgaaagccaggacgacgcggtagaagcgatcctcggtggcaaagttgtcgcgggcg
atgtggtggtgatccgctatgaaggcccgaaaggcggccctggcatgcaggaaatgctct
acccaaccagcttcctgaaatcaatgggtctcggtaaagcctgtgcgctgatcaccgacg
gtcgtttctctggcggcacctctggtctttccatcggccacgtctcaccggaagcggcaa
gcggcggcagcattggcctgattgaagatggtgacctgatcgctatcgacatcccgaacc
gtggcattcagttacaggtaagcgatgccgaactggcggcgcgtcgtgaagcgcaggaag
ctcggggtgacaaagcctggacgccgaaaaaccgtgaacgtcaggtttcctttgccctgc
gtgcctacgccagcctggcgaccagcgccgacaaaggtgcggtgcgcgataaatcgaaac
tggggggttaataatggctgactcgcaacccctgtccggtgctccgggaggtgccgaata
tttaagagcagtgctgcgcgcgccggtttacgaggcggcgcaggttacgccgctacaaaa
aatggaaaaactgtcgtcgcgtcttgataacgtcattctggtgaagcgcgaagatcgcca
gccagtgcacagctttaagctgcgcggcgcatacgccatgatggcgggcctgacggaaga
acaaaaagcgcacggcgtgatcactgcttctgcgggtaaccacgcgcagggcgtcgcgtt
ttcttctgcgcggttaggcgtgaaggccctgatcgttatgccaaccgccaccgccgacat
caaagtcgatgcggtacgtggattcggcggcgaagtgctgcttcatggcgcgaactttga
cgaagcgaaagctaaagcgatcgaactgtcacagcagcaggggttcacctgggtgccgcc
gttcgaccatccgatggtgattgccgggcaa


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search