The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|868203.3.peg.182: Escherichia coli DEC14C

This feature in The SEED Viewer

NCBI Taxonomy Id: 868203

Current Assignment: 2-isopropylmalate synthase (EC 2.3.3.13)
Translate Function Assignments



Context on contig AIHM01000020 from base 69309 to 82694 (13386 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
176 70964 69309 1656 -           SgrR, sugar-phosphate stress, transcriptional activator of SgrS small RNA gene_name|sgrR, locus|ECDEC14C_0060, protein_id|EHX95490.1, gi|378235420
177 71053 71184 132 + 88       dlit(18042713) Sugar-phosphate stress protein SgrT (embedded in SgrS) gene_name|sgrT, locus|ECDEC14C_0061, protein_id|EHX95491.1, gi|378235421
178 71162 72463 1302 + -23         Putative transport protein locus|ECDEC14C_0062, protein_id|EHX95492.1, gi|378235422
179 73117 72512 606 - 48     1: 1 dlit(24561554) 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) gene_name|leuD, locus|ECDEC14C_0063, protein_id|EHX95493.1, gi|378235423
180 74528 73128 1401 - 10     1: 1   3-isopropylmalate dehydratase large subunit (EC 4.2.1.33) gene_name|leuC, locus|ECDEC14C_0064, protein_id|EHX95494.1, gi|378235424
181 75622 74531 1092 - 2     1: 1   3-isopropylmalate dehydrogenase (EC 1.1.1.85) gene_name|leuB, locus|ECDEC14C_0065, protein_id|EHX95495.1, gi|378235425
182 77193 75622 1572 - -1     1: 1   2-isopropylmalate synthase (EC 2.3.3.13) gene_name|leuA, locus|ECDEC14C_0066, protein_id|EHX95496.1, gi|378235426
183 77831 77953 123 + 637         hypothetical protein locus|ECDEC14C_0067, protein_id|EHX95497.1, gi|378235427
184 78030 78974 945 + 76         Probable transcriptional activator for leuABCD operon locus|ECDEC14C_0068, protein_id|EHX95498.1, gi|378235428
185 79316 81016 1701 + 341     1: 1   Acetolactate synthase large subunit (EC 2.2.1.6) locus|ECDEC14C_0071, protein_id|EHX95501.1, gi|378235431
186 81019 81510 492 + 2     1: 1   Acetolactate synthase small subunit (EC 2.2.1.6) locus|ECDEC14C_0072, protein_id|EHX95502.1, gi|378235432
187 81562 81693 132 + 51         hypothetical protein locus|ECDEC14C_0073, protein_id|EHX95503.1, gi|378235433
188 81690 82694 1005 + -4       dlit(8230205) Fructose repressor FruR, LacI family locus|ECDEC14C_0074, protein_id|EHX95504.1, gi|378235434

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user 2-isopropylmalate synthase (EC 2.3.3.13)


  Protein Sequence

>fig|868203.3.peg.182 2-isopropylmalate synthase (EC 2.3.3.13)
MSQQVIIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDVMEVGFPVSSPGDFESVQT
IARQVKNSRVCALARCVEKDIDVAAESLKVAEAFRIHTFIATSPMHIATKLRSTLDEVIE
RAIYMVKRARNYTDDVEFSCEDAGRTPIADLARVVEAAINAGATTINIPDTVGYTMPFEF
AGIISGLYERVPNIDKAIISVHTHDDLGLAVGNSLAAVHAGARQVEGAMNGIGERAGNCS
LEEVIMAIKVRKDILNVHTAINHQEIWRTSQLVSQICNMPIPANKAIVGSGAFAHSSGIH
QDGVLKNRENYEIMTPESIGLNQIQLNLTSRSGRAAVKHRMDEMGYKESEYNLDNLYDAF
LKLADKKGQVFDYDLEALAFIGKQQEEPEHFRLDYFSVQSGSNDIATAAVKLACGEEVKA
EAANGNGPVDAVYQAINRITDYNVELVKYSLTAKGHGKDALGQVDIVANYNGRRFHGVGL
ATDIVESSAKAMVHVLNNIWRAAEVEKELQRKAQHNENNKETV

MD5 = ab388741c1c0209f0fcb6a0a52b241bf


  DNA Sequence

>fig|868203.3.peg.182 2-isopropylmalate synthase (EC 2.3.3.13)
atgagccagcaagtcattattttcgataccacattgcgcgacggtgaacaggcgttacag
gcaagcttgagtgtgaaagaaaaactgcaaattgcgctggcccttgagcgtatgggtgtt
gacgtgatggaagtcggtttccccgtctcttcgccgggcgattttgaatcggtgcaaacc
atcgcccgccaggttaaaaacagccgcgtatgtgcgttagctcgctgcgtggagaaagat
atcgacgtggcggccgaatccctgaaagtcgccgaagccttccgtattcatacctttatt
gccacttcgccaatgcacatcgccaccaagctgcgcagcacgctggatgaagtgatcgaa
cgcgctatctatatggtgaaacgcgcccgtaattacaccgatgatgttgaattttcttgc
gaagatgccgggcgtacacccattgccgatctggcgcgagtggtcgaagcggcgattaat
gccggtgccaccaccatcaacattccggacaccgtgggctacaccatgccgtttgagttc
gccggaatcatcagcggcctgtatgaacgcgtacctaacatcgacaaagccattatttcc
gtacatacccacgacgatttaggcctggcggtcggcaactcactggcggcggtacatgcc
ggtgcacgccaggtggaaggtgcaatgaacgggatcggcgagcgtgccggtaactgttcg
ctggaagaagtcatcatggcgattaaagttcgtaaggatattctcaacgtccacaccgcc
attaatcaccaggagatatggcgcaccagccagttagttagccagatttgtaatatgccg
atcccggcaaacaaagccattgttggcagcggcgcattcgctcactcctccggtatccac
caggatggcgtgctgaaaaaccgcgaaaactacgaaatcatgacaccagaatctattggt
ctgaaccaaatccagctgaatctgacctctcgttcggggcgtgcggcggtgaaacatcgc
atggatgagatggggtataaagaaagtgaatataatttagacaatttgtacgatgctttc
ctgaagctggcggacaaaaaaggtcaggtgtttgattacgatctggaggcgctggccttc
atcggtaagcagcaagaagagccggagcatttccgtctggattacttcagcgtgcagtct
ggctctaacgatatcgccaccgccgccgtcaaactggcctgtggcgaagaagtcaaagca
gaagccgccaacggtaacggtccggtcgatgccgtctatcaggcaattaaccgcatcact
gactataacgtcgaactggtgaaatacagcctgaccgccaaaggtcacggtaaagatgcg
ctgggtcaggtggatattgtcgccaactacaacggtcgccgcttccacggcgtcggcctg
gccaccgatattgtcgagtcctccgccaaagccatggtgcacgtactgaacaatatctgg
cgtgccgcagaagtcgaaaaagagttgcaacgcaaagctcaacacaacgaaaacaacaag
gaaaccgtgtga


  DNA with Flanking Sequence

>fig|868203.3.peg.182 2-isopropylmalate synthase (EC 2.3.3.13)
attcaccaaatcaatatcaaaaaaatcgcaaaacatataattcaatacaaatcatcagga
taggttttgcaacgcgtgcattttgtcccctttttcctcgttgattagatgcaaaaattt
atgctgaaatatgtcaaccgatgaaaagcgtcggtagttaagcagaaattaatatcgctt
actttaaccaccgcagcacaattagctaattttacggatgcagaactcacgctggcggga
cgtttttattgcgtcagggttgacatccgtttttgtatccagtaactctaaaagcatatc
gcattcatctggagctgatttaatgactcacatcgttcgctttatcggtctactactact
aaacgcatcttctttgcgcggtagacgagtgagcggcatccagcattaagccagcacgca
gtcaaacaaaaaacccgcgccattgcgcgggttttttatgcccgaagcgaggcgctctaa
aagagacaaggacccaaaccatgagccagcaagtcattattttcgataccacattgcgcg
acggtgaacaggcgttacaggcaagcttgagtgtgaaagaaaaactgcaaattgcgctgg
cccttgagcgtatgggtgttgacgtgatggaagtcggtttccccgtctcttcgccgggcg
attttgaatcggtgcaaaccatcgcccgccaggttaaaaacagccgcgtatgtgcgttag
ctcgctgcgtggagaaagatatcgacgtggcggccgaatccctgaaagtcgccgaagcct
tccgtattcatacctttattgccacttcgccaatgcacatcgccaccaagctgcgcagca
cgctggatgaagtgatcgaacgcgctatctatatggtgaaacgcgcccgtaattacaccg
atgatgttgaattttcttgcgaagatgccgggcgtacacccattgccgatctggcgcgag
tggtcgaagcggcgattaatgccggtgccaccaccatcaacattccggacaccgtgggct
acaccatgccgtttgagttcgccggaatcatcagcggcctgtatgaacgcgtacctaaca
tcgacaaagccattatttccgtacatacccacgacgatttaggcctggcggtcggcaact
cactggcggcggtacatgccggtgcacgccaggtggaaggtgcaatgaacgggatcggcg
agcgtgccggtaactgttcgctggaagaagtcatcatggcgattaaagttcgtaaggata
ttctcaacgtccacaccgccattaatcaccaggagatatggcgcaccagccagttagtta
gccagatttgtaatatgccgatcccggcaaacaaagccattgttggcagcggcgcattcg
ctcactcctccggtatccaccaggatggcgtgctgaaaaaccgcgaaaactacgaaatca
tgacaccagaatctattggtctgaaccaaatccagctgaatctgacctctcgttcggggc
gtgcggcggtgaaacatcgcatggatgagatggggtataaagaaagtgaatataatttag
acaatttgtacgatgctttcctgaagctggcggacaaaaaaggtcaggtgtttgattacg
atctggaggcgctggccttcatcggtaagcagcaagaagagccggagcatttccgtctgg
attacttcagcgtgcagtctggctctaacgatatcgccaccgccgccgtcaaactggcct
gtggcgaagaagtcaaagcagaagccgccaacggtaacggtccggtcgatgccgtctatc
aggcaattaaccgcatcactgactataacgtcgaactggtgaaatacagcctgaccgcca
aaggtcacggtaaagatgcgctgggtcaggtggatattgtcgccaactacaacggtcgcc
gcttccacggcgtcggcctggccaccgatattgtcgagtcctccgccaaagccatggtgc
acgtactgaacaatatctggcgtgccgcagaagtcgaaaaagagttgcaacgcaaagctc
aacacaacgaaaacaacaaggaaaccgtgtgatgtcgaagaattaccatattgccgtatt
gccgggggacggtattggtccggaagtgatgacccaggcgctgaaagtgctggatgccgt
gcgcaaccgctttgcgatgcgcatcaccaccagccattacgatgtaggcggcgcagccat
tgataaccacgggcaaccactgccgcctgcgacggttgaaggttgtgagcaagccgatgc
cgtgctgtttggctcggtaggcggtccgaaatgggaacatttaccaccagaccagcaacc
agaacgcggcgcgctgttgcctttgcgtaagcacttcaaattattcagcaacctgcgccc
ggcaaaactgtatcaggggctggaagcattctgtccgctgcgtgcagacattgccgctaa
cggcttcgacatcctgtgcgtgcgcgaactgaccggcggcatctatttcggtcagccaaa
aggccgcgaaggtagcggacaatatgaaaaagcgtttgataccgaggtgtat


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search