The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|868181.3.peg.4885: Escherichia coli DEC10B

This feature in The SEED Viewer

NCBI Taxonomy Id: 868181

Current Assignment: Branched-chain amino acid ABC transporter, ATP-binding protein LivF
Translate Function Assignments



Context on contig AIGQ01000069 from base 118724 to 129717 (10994 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
4879 119467 118724 744 -           Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46) gene_name|ugpQ, locus|ECDEC10B_4916, protein_id|EHW64543.1, gi|378102871
4880 120534 119464 1071 - -4         Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3) gene_name|ugpC, locus|ECDEC10B_4917, protein_id|EHW64544.1, gi|378102872
4881 121381 120536 846 - 1         Glycerol-3-phosphate ABC transporter (EC 7.6.2.10), permease protein UgpE locus|ECDEC10B_4918, protein_id|EHW64545.1, gi|378102873
4882 122265 121378 888 - -4         Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3) gene_name|ugpA, locus|ECDEC10B_4919, protein_id|EHW64546.1, gi|378102874
4883 123679 122363 1317 - 97       dlit(3062310)
dlit(8407831)
Glycerol-3-phosphate ABC transporter (EC 7.6.2.10), substrate-binding protein UgpB gene_name|ugpB, locus|ECDEC10B_4920, protein_id|EHW64547.1, gi|378102875
4884 124008 123892 117 - 212         FIG00641395: hypothetical protein locus|ECDEC10B_4921, protein_id|EHW64548.1, gi|378102876
4885 124788 124075 714 - 66     1: 1   Branched-chain amino acid ABC transporter, ATP-binding protein LivF locus|ECDEC10B_4922, protein_id|EHW64549.1, gi|378102877
4886 125557 124790 768 - 1     1: 1 dlit(2195019) Branched-chain amino acid ABC transporter, ATP-binding protein LivG locus|ECDEC10B_4923, protein_id|EHW64550.1, gi|378102878
4887 126831 125554 1278 - -4     1: 1   Branched-chain amino acid ABC transporter, permease protein LivM (TC 3.A.1.4.1) locus|ECDEC10B_4924, protein_id|EHW64551.1, gi|378102879
4888 127754 126828 927 - -4     1: 1 dlit(2195019) Branched-chain amino acid ABC transporter, permease protein LivH locus|ECDEC10B_4925, protein_id|EHW64552.1, gi|378102880
4889 128992 127802 1191 - 47     1: 1   High-affinity leucine-specific transport system, periplasmic binding protein LivK (TC 3.A.1.4.1) locus|ECDEC10B_4926, protein_id|EHW64553.1, gi|378102881
4890 129199 129062 138 - 69         FIG00638710: hypothetical protein locus|ECDEC10B_4927, protein_id|EHW64554.1, gi|378102882
4891 129334 129717 384 + 134         Acetyl-CoA sensor PanM, required for maturation of L-aspartate decarboxylase locus|ECDEC10B_4928, protein_id|EHW64555.1, gi|378102883

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user Branched-chain amino acid ABC transporter, ATP-binding protein LivF (TC 3.A.1.4.1)


  Protein Sequence

>fig|868181.3.peg.4885 Branched-chain amino acid ABC transporter, ATP-binding protein LivF
MEKVMLSFDKVSAHYGKIQALHEVSLHINQGEIVTLIGANGAGKTTLLGTLCGDPRATSG
RIVFDDKDITDWQTAKIMREAVAIVPEGRRVFSRMTVEENLAMGGFFAERDQFQERIKWV
YELFPRLHERRVQRAGTMSGGEQQMLAIGRALMSNPRLLLLDEPSLGLAPIIIQQIFDTI
EQLREQGMTIFLVEQNANQALKLADRGYVLENGHVVLSDTGDALLANEAVRSAYLGG

MD5 = 37548f635b68dea3138128a61e47bfbc


  DNA Sequence

>fig|868181.3.peg.4885 Branched-chain amino acid ABC transporter, ATP-binding protein LivF
atggaaaaagtcatgttgtcctttgacaaagtcagcgcccactacggcaaaatccaggcg
ctgcatgaggtgagcctgcatatcaatcagggcgagattgtcaccctcattggcgcgaac
ggggcggggaaaaccaccttgctcggcacgttatgcggcgatccgcgcgctaccagcggg
cgaattgtgtttgatgataaagacattaccgactggcagacggcgaaaatcatgcgcgaa
gcggtagcgattgtcccggaagggcgtcgcgtcttctcgcggatgacggtggaagagaac
ctggcgatgggcggcttttttgccgaacgcgaccagttccaggagcgcataaagtgggtg
tatgaactgtttccacgtctgcatgagcgccgtgttcagcgggcaggcaccatgtccggc
ggtgagcaacaaatgctggcgattggtcgcgcgctgatgagcaacccgcgtttgctgcta
cttgatgagccatcgctcggtcttgcgccgattatcatccagcaaattttcgacaccatc
gagcagctgcgcgagcaggggatgactatcttcctcgtcgagcagaacgccaaccaggcg
ctaaagctggcggatcgcggctacgtgctggaaaacggccatgtggtgctctccgatacc
ggcgacgcgctgctggcgaacgaagcagtgagaagtgcgtatttaggcgggtaa


  DNA with Flanking Sequence

>fig|868181.3.peg.4885 Branched-chain amino acid ABC transporter, ATP-binding protein LivF
tctgttccgtgaaatgacggtgattgaaaacctgctggtggcgcagcatcaacaactgaa
aaccgggctgttctctggcctgttgaaaacgccttctttccgtcgcgcccagagcgaagc
gctcgaccgcgccgccacctggcttgagcgcattggtttgctggaacacgccaaccgtca
ggcgagtaacctggcctatggtgaccaacgccgtctggagattgcccgctgcatggtgac
gcagccggagattttaatgctcgacgaaccggcggcaggtcttaacccaaaagaaaccaa
agagctggatgagctgattgccgaactgcgcaatcatcacaacaccactatcttgttgat
tgaacacgatatgaagctggtgatggggatttcagaccgaatttatgtggtcaatcaggg
gacgccactggcaaacggtacgccggagcaaatccgtaataacccggacgtgatccgtgc
ctatttaggtgaggcataagatggaaaaagtcatgttgtcctttgacaaagtcagcgccc
actacggcaaaatccaggcgctgcatgaggtgagcctgcatatcaatcagggcgagattg
tcaccctcattggcgcgaacggggcggggaaaaccaccttgctcggcacgttatgcggcg
atccgcgcgctaccagcgggcgaattgtgtttgatgataaagacattaccgactggcaga
cggcgaaaatcatgcgcgaagcggtagcgattgtcccggaagggcgtcgcgtcttctcgc
ggatgacggtggaagagaacctggcgatgggcggcttttttgccgaacgcgaccagttcc
aggagcgcataaagtgggtgtatgaactgtttccacgtctgcatgagcgccgtgttcagc
gggcaggcaccatgtccggcggtgagcaacaaatgctggcgattggtcgcgcgctgatga
gcaacccgcgtttgctgctacttgatgagccatcgctcggtcttgcgccgattatcatcc
agcaaattttcgacaccatcgagcagctgcgcgagcaggggatgactatcttcctcgtcg
agcagaacgccaaccaggcgctaaagctggcggatcgcggctacgtgctggaaaacggcc
atgtggtgctctccgataccggcgacgcgctgctggcgaacgaagcagtgagaagtgcgt
atttaggcgggtaataacacgttgattgataaggagtcaaaagactcctttgagacaggt
gacaaatgtaaaattgcctgatgcgctgcgcttatcaggcctactgggtgagttgcaata
tattgaatttgcacgatcttgtaggccggataaggcgtttacgccgcatccggcatgaaa
cgatgggtaatctgtagagtttgattcagaccttctattttccgcttatccgtgccccat
ctcccattttccctcacccacgccgtcaccgccttgtcatctttctgacaccttactatc
ttacaaatgtaacaaaaaagttatttttctgtaattcgagcatgtcatgttaccccgcga
gcataaaacgcgtgaattcgcgcattcggtacaacaagagagataaacgatgaaaccgtt
acattatacagcttcagcactggcgctcggactggcgttaatggggaatgcacaggcagt
gacgaccattccgttctggcattctatggaaggg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search