The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|868161.3.peg.4336: Escherichia coli DEC6B

This feature in The SEED Viewer

NCBI Taxonomy Id: 868161

Current Assignment: Branched-chain amino acid ABC transporter, permease protein LivM
Translate Function Assignments



Context on contig AIFW01000042 from base 164530 to 176131 (11602 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
4330 165375 164530 846 -           Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3) locus|ECDEC6B_4449, protein_id|EHV53104.1, gi|377989938
4331 166259 165372 888 - -4       dlit(3062310)
dlit(8407831)
Glycerol-3-phosphate ABC transporter (EC 7.6.2.10), permease protein UgpA gene_name|ugpA, locus|ECDEC6B_4450, protein_id|EHV53030.1, gi|377989864
4332 167673 166357 1317 - 97       dlit(3062310)
dlit(8407831)
Glycerol-3-phosphate ABC transporter (EC 7.6.2.10), substrate-binding protein UgpB gene_name|ugpB, locus|ECDEC6B_4451, protein_id|EHV52845.1, gi|377989679
4333 168005 167889 117 - 215         FIG00641395: hypothetical protein locus|ECDEC6B_4452, protein_id|EHV53071.1, gi|377989905
4334 168785 168072 714 - 66     1: 1 dlit(2195019) Branched-chain amino acid ABC transporter, ATP-binding protein LivF locus|ECDEC6B_4453, protein_id|EHV53099.1, gi|377989933
4335 169554 168787 768 - 1     1: 1 dlit(2195019) Branched-chain amino acid ABC transporter, ATP-binding protein LivG locus|ECDEC6B_4454, protein_id|EHV52781.1, gi|377989615
4336 170828 169551 1278 - -4     1: 1 dlit(2195019) Branched-chain amino acid ABC transporter, permease protein LivM locus|ECDEC6B_4455, protein_id|EHV52806.1, gi|377989640
4337 171751 170825 927 - -4     1: 1 dlit(2195019) Branched-chain amino acid ABC transporter, permease protein LivH locus|ECDEC6B_4456, protein_id|EHV52922.1, gi|377989756
4338 172908 171799 1110 - 47     1: 1 dlit(2195019) Leucine-specific ABC transporter, substrate-binding protein LivK locus|ECDEC6B_4457, protein_id|EHV53029.1, gi|377989863
4339 173197 173060 138 - 151         FIG00638710: hypothetical protein  
4340 173332 173715 384 + 134       dlit(23170229) Acetyl-CoA sensor PanM, required for maturation of L-aspartate decarboxylase locus|ECDEC6B_4459, protein_id|EHV52688.1, gi|377989522
4341 173852 173712 141 - -4         hypothetical protein  
4342 175006 173903 1104 - 50     1: 1 dlit(2195019) Branched-chain amino acid ABC transporter, substrate-binding protein LivJ locus|ECDEC6B_4460, protein_id|EHV53016.1, gi|377989850
4343 176131 175277 855 - 270       dlit(2841288)
dlit(6380765)
RNA polymerase sigma factor RpoH gene_name|rpoH, locus|ECDEC6B_4461, protein_id|EHV52977.1, gi|377989811

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user Branched-chain amino acid ABC transporter, permease protein LivM (TC 3.A.1.4.1)


  Protein Sequence

>fig|868161.3.peg.4336 Branched-chain amino acid ABC transporter, permease protein LivM
MKPMHIAMALLSAAMFFVLAGVFMGVQLELDGTKLVVDTASDVRWQWVFIGTAVVFFFQL
LRPAFQKGLKSVSGPKFILPAIDGSTVKQKLFLVALLVLAVAWPFMVSRGTVDIATLTMI
YIILGLGLNVVVGLSGLLVLGYGGFYAIGAYTFALLNHYYGLGFWTCLPIAGLMAAAAGF
LLGFPVLRLRGDYLAIVTLGFGEIVRILLLNNTEITGGPNGISQIPKPTLFGLEFSRTAR
EGGWDTFSNFFGLKYDPSDRVIFLYLVALLLVVLSLFVINRLLRMPLGRAWEALREDEIA
CRSLGLSPRRIKLTAFTISAAFAGFAGTLFAARQGFVSPESFTFAESAFVLAIVVLGGMG
SQFAVILAAILLVVSRELMRDFNEYSMLMLGGLMVLMMIWRPQGLLPMTRPQLKLKNGAA
KGEQA

MD5 = 7d13e3f23851d016af581d6dfed098b4


  DNA Sequence

>fig|868161.3.peg.4336 Branched-chain amino acid ABC transporter, permease protein LivM
atgaaaccgatgcatattgcaatggcgctgctctctgccgcgatgttctttgtgctggcg
ggcgtctttatgggcgtgcaactggagctggatggcaccaaactggtggtcgacacggct
tcggatgtccgttggcagtgggtgtttatcggcacggcggtggtctttttcttccagctt
ttgcgaccggctttccagaaagggttgaaaagcgtttccggaccgaagtttattctgccc
gccattgatggctccacggtgaagcagaaactgttcctcgtggcgctgttggtgcttgcg
gtggcgtggccgtttatggtttcacgcgggacggtggatattgccaccctgaccatgatc
tacattatcctcggtctcgggctgaacgtggttgttggtctttctggtctgctggtgctg
gggtacggcggtttttacgccatcggcgcttacacttttgcgctgctcaatcactattac
ggcttgggcttctggacctgcctgccgattgctggattaatggcagcggcggcgggcttc
ctgctcggttttccggtgctgcgtttgcgcggtgactatctggcgatcgttaccctcggt
ttcggcgaaattgtgcgcatattgctgctcaataacaccgaaattaccggcggcccgaac
ggaatcagtcagatcccgaaaccgacactcttcggactcgagttcagccgtaccgctcgt
gaaggcggctgggacacgttcagtaatttctttggcctgaaatacgatccctccgatcgt
gtcatcttcctctacctggtggcgttgctgctggtggtgctaagcctgtttgtcattaac
cgcctgctgcggatgccgctggggcgtgcgtgggaagcgttgcgtgaagatgaaatcgcc
tgccgttcgctgggcttaagcccgcgtcgtatcaagctgactgcctttaccataagtgcc
gcgtttgccggttttgccggaacgctgtttgcggcgcgtcagggctttgtcagcccggaa
tccttcacctttgccgaatcggcgtttgtgctggcgatagtggtgctcggcggtatgggc
tcgcaatttgcggtgattctggcggcaattttgctggtggtgtcgcgcgagttgatgcgt
gatttcaacgaatacagcatgttaatgctcggtggtttgatggtgctgatgatgatctgg
cgtccgcagggcttgctgcccatgacgcgcccgcaactgaagctgaaaaacggcgcagcg
aaaggagagcaggcatga


  DNA with Flanking Sequence

>fig|868161.3.peg.4336 Branched-chain amino acid ABC transporter, permease protein LivM
gtggtggggcatagcgaaaacttctctgcctctattaccaccatgcaggcggtgatctgg
attgttaccttcctcgccatgctggcgctgacgattttcattcgctattcccgcatgggt
cgcgcgtgtcgtgcctgcgcggaagatctgaaaatggcgagtctgcttggcattaacacc
gaccgggtgattgcgctgacctttgtgattggcgcggcgatggcggcggtggcgggtgtg
ctgctcggtcagttctacggcgtcattaacccctacatcggctttatggccgggatgaaa
gcctttaccgcggcggtgctcggtgggattggcagcattccgggagcgatgattggcggc
ctgattctggggattgcggaggcgctctcttctgcctatctgagtacggaatataaagat
gtggtctcattcgccctgctgattctggtgctgctggtgatgccgaccggtattctgggt
cgcccggaggtagagaaagtatgaaaccgatgcatattgcaatggcgctgctctctgccg
cgatgttctttgtgctggcgggcgtctttatgggcgtgcaactggagctggatggcacca
aactggtggtcgacacggcttcggatgtccgttggcagtgggtgtttatcggcacggcgg
tggtctttttcttccagcttttgcgaccggctttccagaaagggttgaaaagcgtttccg
gaccgaagtttattctgcccgccattgatggctccacggtgaagcagaaactgttcctcg
tggcgctgttggtgcttgcggtggcgtggccgtttatggtttcacgcgggacggtggata
ttgccaccctgaccatgatctacattatcctcggtctcgggctgaacgtggttgttggtc
tttctggtctgctggtgctggggtacggcggtttttacgccatcggcgcttacacttttg
cgctgctcaatcactattacggcttgggcttctggacctgcctgccgattgctggattaa
tggcagcggcggcgggcttcctgctcggttttccggtgctgcgtttgcgcggtgactatc
tggcgatcgttaccctcggtttcggcgaaattgtgcgcatattgctgctcaataacaccg
aaattaccggcggcccgaacggaatcagtcagatcccgaaaccgacactcttcggactcg
agttcagccgtaccgctcgtgaaggcggctgggacacgttcagtaatttctttggcctga
aatacgatccctccgatcgtgtcatcttcctctacctggtggcgttgctgctggtggtgc
taagcctgtttgtcattaaccgcctgctgcggatgccgctggggcgtgcgtgggaagcgt
tgcgtgaagatgaaatcgcctgccgttcgctgggcttaagcccgcgtcgtatcaagctga
ctgcctttaccataagtgccgcgtttgccggttttgccggaacgctgtttgcggcgcgtc
agggctttgtcagcccggaatccttcacctttgccgaatcggcgtttgtgctggcgatag
tggtgctcggcggtatgggctcgcaatttgcggtgattctggcggcaattttgctggtgg
tgtcgcgcgagttgatgcgtgatttcaacgaatacagcatgttaatgctcggtggtttga
tggtgctgatgatgatctggcgtccgcagggcttgctgcccatgacgcgcccgcaactga
agctgaaaaacggcgcagcgaaaggagagcaggcatgagtcagccattattatctgttaa
cggcctgatgatgcgcttcggcggcctgctggcggtgaacaacgtcaatcttgaactgta
cccgcaggagatcgtctcgttaatcggccctaacggtgccggaaaaaccacggtttttaa
ctgtctgaccggattctacaaacccaccggcggcaccattttactgcgcgatcagcacct
ggaaggtttaccggggcagcaaattgcccgcatgggcgtggtgcgcaccttccagcatgt
gcgtctgttccgtgaaatgacggtaattgaaaacctgctggtggcgcagcatcagcaact
gaaaaccgggctgttctctggcctgttgaaaacgccatccttccgtcgcgcccagagcga
agcgctcgaccgcgccgcgacctggcttgagcgcattggtttgctggaacacgccaaccg
tcaggcgagtaacctggcctatggtgaccagcgccgtcttgagattgcccgctgcatg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(2195019);gjo


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search