The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|868135.3.peg.4614: Escherichia coli DEC1C

This feature in The SEED Viewer

NCBI Taxonomy Id: 868135

Current Assignment: Branched-chain amino acid aminotransferase (EC 2.6.1.42)
Translate Function Assignments



Context on contig AIEX01000071 from base 5472 to 17733 (12262 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
4609 6311 5472 840 -         dlit(10913108) HTH-type transcriptional regulator hdfR gene_name|hdfR, locus|ECDEC1C_4588, protein_id|EHU03997.1, gi|377838893
4610 6430 6768 339 + 118         UPF0438 protein YifE locus|ECDEC1C_4589, protein_id|EHU03998.1, gi|377838894
4611 8313 6793 1521 - 24         MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein gene_name|comM, locus|ECDEC1C_4590, protein_id|EHU03999.1, gi|377838895
4612 8904 10550 1647 + 590     1: 1   Acetolactate synthase large subunit (EC 2.2.1.6) locus|ECDEC1C_4591, protein_id|EHU04000.1, gi|377838896
4613 10547 10810 264 + -4     1: 1 dlit(3550695) Acetolactate synthase small subunit (EC 2.2.1.6) gene_name|ilvM, locus|ECDEC1C_4592, protein_id|EHU04001.1, gi|377838897
4614 10830 11759 930 + 19     3: 4 1 2 dlit(9163511)
dlit(3550695)
dlit(3897211)
dlit(3069843)
Branched-chain amino acid aminotransferase (EC 2.6.1.42) gene_name|ilvE, locus|ECDEC1C_4593, protein_id|EHU04002.1, gi|377838898
4615 11824 13674 1851 + 64     1: 1   Dihydroxy-acid dehydratase (EC 4.2.1.9) gene_name|ilvD, locus|ECDEC1C_4594, protein_id|EHU04003.1, gi|377838899
4616 13677 15221 1545 + 2     1: 1   Threonine dehydratase biosynthetic (EC 4.3.1.19) gene_name|ilvA, locus|ECDEC1C_4595, protein_id|EHU04004.1, gi|377838900
4617 16108 15218 891 - -4         HTH-type transcriptional regulator IlvY locus|ECDEC1C_4596, protein_id|EHU04005.1, gi|377838901
4618 16258 17733 1476 + 149     2: 1 3   Ketol-acid reductoisomerase (EC 1.1.1.86) gene_name|ilvC, locus|ECDEC1C_4597, protein_id|EHU04006.1, gi|377838902

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Aminotransferases:Aromatic_Pathway_and_More,_A_work_in_progress carolb Branched-chain amino acid aminotransferase (EC 2.6.1.42)
PLP_Y_genes El_Yacoubi_Basma_user Branched-chain amino acid aminotransferase (EC 2.6.1.42)
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user Branched-chain amino acid aminotransferase (EC 2.6.1.42)


  Protein Sequence

>fig|868135.3.peg.4614 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
MTTKKADYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQR
LHDSAKIYRFPVSQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDV
IIAAFPWGAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGY
QEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVREQ
VLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTGETEDK
WGWLDQVNQ

MD5 = 1d3a670d1bfad1175025fba33bbc4a4c


  DNA Sequence

>fig|868135.3.peg.4614 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
atgaccacgaagaaagctgattacatttggttcaatggggagatggttcgctgggaagac
gcgaaggtgcatgtgatgtcgcacgcgctgcactatggcacctcggtttttgaaggcatc
cgttgctacgactcgcacaaaggaccggttgtattccgccatcgtgagcatatgcagcgt
ctgcatgactccgccaaaatctatcgcttcccggtttcgcagagcattgatgagctgatg
gaagcttgtcgtgacgtgatccgcaaaaacaatctcaccagcgcctatatccgtccgctg
atcttcgttggtgatgttggcatgggcgtaaacccgccagcgggatactcaaccgacgtg
attatcgccgctttcccgtggggagcgtatctgggcgcagaagcgctggagcaggggatc
gatgcgatggtttcctcctggaaccgcgcagcaccaaacaccatcccgacggcggcaaaa
gccggtggtaactacctctcttccctgctggtgggtagcgaagcgcgccgccacggttat
caggaaggtatcgcgttggatgtgaatggttacatctctgaaggcgcaggcgaaaacctg
tttgaagtgaaagacggcgtgctgttcaccccaccgttcacctcatccgcgctgccgggt
attacccgtgatgccatcatcaaactggcaaaagagctgggaattgaagtgcgtgagcag
gtgctgtcgcgcgaatccctgtacctggcggatgaagtgtttatgtccggtacggcggca
gaaatcacgccagtgcgcagcgtagacggtattcaggttggcgaaggccgttgtggcccg
gttaccaaacgcattcagcaagccttcttcggcctcttcactggcgaaaccgaagataaa
tggggctggttagatcaagttaatcaataa


  DNA with Flanking Sequence

>fig|868135.3.peg.4614 Branched-chain amino acid aminotransferase (EC 2.6.1.42)
caacccttaccgataaccccgatttcctcatgttagccagcgccttcggcatccctggcc
aacacatcacccgtaaagaccaggttgaagcggcactcgacaccatgctgaacagtgatg
ggccatacctgcttcatgtctcaatcgacgaacttgagaacgtctggccgctggtgccgc
caggtgccagtaattcagaaatgttggagaaattatcatgatgcaacatcaggtcaatgt
atcggctcgcttcaatccggaaaccttagaacgtgttttacgcgtggtgcgtcatcgtgg
tttccacgtctgctcaatgaatatggccgccgccagcgatgcacaaaatataaatatcga
attgaccgttgccagcccacggtcggtcgacttactgtttagtcagttaaataaactggt
ggacgtcgcacacgttgctatctgccagagcacaaccacatcacaacaaatccgcgcctg
agcgcaaaaggaatataaaaatgaccacgaagaaagctgattacatttggttcaatgggg
agatggttcgctgggaagacgcgaaggtgcatgtgatgtcgcacgcgctgcactatggca
cctcggtttttgaaggcatccgttgctacgactcgcacaaaggaccggttgtattccgcc
atcgtgagcatatgcagcgtctgcatgactccgccaaaatctatcgcttcccggtttcgc
agagcattgatgagctgatggaagcttgtcgtgacgtgatccgcaaaaacaatctcacca
gcgcctatatccgtccgctgatcttcgttggtgatgttggcatgggcgtaaacccgccag
cgggatactcaaccgacgtgattatcgccgctttcccgtggggagcgtatctgggcgcag
aagcgctggagcaggggatcgatgcgatggtttcctcctggaaccgcgcagcaccaaaca
ccatcccgacggcggcaaaagccggtggtaactacctctcttccctgctggtgggtagcg
aagcgcgccgccacggttatcaggaaggtatcgcgttggatgtgaatggttacatctctg
aaggcgcaggcgaaaacctgtttgaagtgaaagacggcgtgctgttcaccccaccgttca
cctcatccgcgctgccgggtattacccgtgatgccatcatcaaactggcaaaagagctgg
gaattgaagtgcgtgagcaggtgctgtcgcgcgaatccctgtacctggcggatgaagtgt
ttatgtccggtacggcggcagaaatcacgccagtgcgcagcgtagacggtattcaggttg
gcgaaggccgttgtggcccggttaccaaacgcattcagcaagccttcttcggcctcttca
ctggcgaaaccgaagataaatggggctggttagatcaagttaatcaataaatacaaaaaa
tgggacggcacgcaccgtcccatttacgagacagacactgggagtaaataaagtatgcct
aagtaccgttccgccaccaccactcatggtcgtaatatggcgggtgctcgtgcgctgtgg
cgcgccaccggaatgaccgacgccgattttggtaagccgattatcgcggttgtgaactcg
ttcacccaatttgtaccgggtcacgtccatctacgcgatctcggtaaactggttgccgaa
caaattgaagcggctggcggcgttgccaaagagttcaacaccattgcggtggatgatggg
atcgctatgggccacgggggcatgctttattcactgccatctcgcgaactgatcgctgat
tccgttgaatatatggtcaacgcccactgcgccgacgccatggtctgcatctctaactgc
gacaaaatcaccccggggatgctgatggcttccctgcgcctgaatattccggtgatcttt
gtttccggcg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(3069843);RossO
evidence_code dlit(3550695);RossO
evidence_code dlit(3897211);RossO
evidence_code dlit(9163511);RossO


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search