The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|868135.3.peg.227: Escherichia coli DEC1C

This feature in The SEED Viewer

NCBI Taxonomy Id: 868135

Current Assignment: 3-isopropylmalate dehydrogenase (EC 1.1.1.85)
Translate Function Assignments



Context on contig AIEX01000020 from base 73955 to 85589 (11635 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
221 74938 73955 984 -       2: 3 2   Thiamin ABC transporter, substrate-binding component gene_name|thiB, locus|ECDEC1C_0067, protein_id|EHU16471.1, gi|377851526
222 75101 74982 120 - 43         putative lipoprotein  
223 76757 75102 1656 - 0         SgrR, sugar-phosphate stress, transcriptional activator of SgrS small RNA gene_name|sgrR, locus|ECDEC1C_0068, protein_id|EHU16472.1, gi|377851527
224 76846 76977 132 + 88         Sugar-phosphate stress protein SgrT (embedded in SgrS) gene_name|sgrT, locus|ECDEC1C_0069, protein_id|EHU16473.1, gi|377851528
225 77690 77085 606 - 107     1: 1   3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) gene_name|leuD, locus|ECDEC1C_0070, protein_id|EHU16474.1, gi|377851529
226 79101 77701 1401 - 10     1: 1   3-isopropylmalate dehydratase large subunit (EC 4.2.1.33) gene_name|leuC, locus|ECDEC1C_0071, protein_id|EHU16475.1, gi|377851530
227 80195 79104 1092 - 2     1: 1   3-isopropylmalate dehydrogenase (EC 1.1.1.85) gene_name|leuB, locus|ECDEC1C_0072, protein_id|EHU16476.1, gi|377851531
228 81766 80195 1572 - -1     1: 1   2-isopropylmalate synthase (EC 2.3.3.13) gene_name|leuA, locus|ECDEC1C_0073, protein_id|EHU16477.1, gi|377851532
229 82404 82526 123 + 637         hypothetical protein  
230 82603 83547 945 + 76         Probable transcriptional activator for leuABCD operon locus|ECDEC1C_0074, protein_id|EHU16478.1, gi|377851533
231 83889 85589 1701 + 341     1: 1   Acetolactate synthase large subunit (EC 2.2.1.6) locus|ECDEC1C_0075, protein_id|EHU16479.1, gi|377851534

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user 3-isopropylmalate dehydrogenase (EC 1.1.1.85)


  Protein Sequence

>fig|868135.3.peg.227 3-isopropylmalate dehydrogenase (EC 1.1.1.85)
MSKNYHIAVLPGDGIGPEVMTQALKVLDAVRNRFAMRITTSHYDVGGAAIDNHGQPLPPA
TVEGCEQADAVLFGSVGGPKWEHLPPDQQPERGALLPLRKHFKLFSNLRPAKLYQGLEAF
CPLRADIAANGFDILCVRELTGGIYFGQPKGREGSGQYEKAFDTEVYHRFEIERIARIAF
ESARKRRHKVTSIDKANVLQSSILWREIVNEIATEYPDVELAHMYIDNATMQLIKDPSQF
DVLLCSNLFGDILSDECAMITGSMGMLPSASLNEQGFGLYEPAGGSAPDIAGKNIANPIA
QILSLALLLRYSLDADDAASAIERAINRALEEGIRTGDLARGAAAVSTDEMGDIIARYVA
EGV

MD5 = d6b87d23a1d192a2690634c446c138b9


  DNA Sequence

>fig|868135.3.peg.227 3-isopropylmalate dehydrogenase (EC 1.1.1.85)
atgtcgaagaattaccatattgccgtattgccgggggacggtattggtccggaagtgatg
acccaggcgctgaaagtgctggatgccgtgcgcaaccgatttgcgatgcgtatcaccacc
agccattacgatgtaggcggcgcagccattgataaccacgggcagccgctgccgcctgcg
acggttgaaggttgtgagcaagccgatgccgtgctgtttggctcggtaggcggtccgaag
tgggaacatttaccaccagaccagcaaccagaacgcggcgcgctgctgcctctgcgtaag
cacttcaaattattcagcaacctgcgcccggcaaaactgtatcaggggctggaagcattc
tgtccgctgcgtgcagacattgccgcaaacggctttgacatcctgtgtgtgcgcgaactg
accggcggcatctatttcggtcagccaaaaggccgcgaaggtagcggacaatatgaaaaa
gcgtttgataccgaggtgtaccaccgttttgagatcgagcgtattgcccgcatcgcattt
gaatcagcccgcaagcgtcgccacaaagtcacctcaatcgacaaagccaacgtgctgcaa
tcctctattttatggcgggagatcgttaacgagatcgccacggaatacccggacgtcgaa
ctggcgcatatgtacatcgacaacgccaccatgcagctgattaaagatccatcacagttt
gacgtcttgctgtgctccaacctgtttggcgacattctgtctgatgagtgcgcaatgatc
actggctcaatggggatgttgccttccgccagcctgaacgagcaaggttttggtctgtat
gaaccggcgggcggctcggcacccgatatcgcaggtaaaaatatcgccaacccgattgca
caaattctgtcgctggcgctgctgctgcgttacagcctggatgccgatgatgcggcttcc
gccattgaacgcgccattaaccgcgcattagaagaaggcattcgcaccggggatttagcc
cgtggcgctgccgccgttagtaccgatgaaatgggcgatatcattgcccgctatgtggca
gaaggggtgtaa


  DNA with Flanking Sequence

>fig|868135.3.peg.227 3-isopropylmalate dehydrogenase (EC 1.1.1.85)
gacgctttcctgaagctggcggacaaaaaaggccaggtgtttgattacgatctggaggcg
ctggccttcatcggtaagcagcaagaagagccggagcatttccgtctggattacttcagc
gtgcagtctggctctaacgatatcgccactgccgccgtcaaactggcctgtggcgaagaa
gtcaaagcagaagccgccaacggtaacggtccggttgatgccgtctaccaggcgataaac
cgcatcactgactataacgtcgaactggtgaaatacagcctgaccgccaaaggccacggt
aaagatgcgctgggtcaggtggatattgtcgccaactacaacggtcgccgcttccacggc
gtcggcctggccaccgatattgtcgagtcctccgccaaagccatggtgcacgtactgaac
aatatctggcgtgccgcagaagtcgaaaaagagttgcaacgcaaagctcaacacaacgaa
aacaacaaggaaaccgtgtgatgtcgaagaattaccatattgccgtattgccgggggacg
gtattggtccggaagtgatgacccaggcgctgaaagtgctggatgccgtgcgcaaccgat
ttgcgatgcgtatcaccaccagccattacgatgtaggcggcgcagccattgataaccacg
ggcagccgctgccgcctgcgacggttgaaggttgtgagcaagccgatgccgtgctgtttg
gctcggtaggcggtccgaagtgggaacatttaccaccagaccagcaaccagaacgcggcg
cgctgctgcctctgcgtaagcacttcaaattattcagcaacctgcgcccggcaaaactgt
atcaggggctggaagcattctgtccgctgcgtgcagacattgccgcaaacggctttgaca
tcctgtgtgtgcgcgaactgaccggcggcatctatttcggtcagccaaaaggccgcgaag
gtagcggacaatatgaaaaagcgtttgataccgaggtgtaccaccgttttgagatcgagc
gtattgcccgcatcgcatttgaatcagcccgcaagcgtcgccacaaagtcacctcaatcg
acaaagccaacgtgctgcaatcctctattttatggcgggagatcgttaacgagatcgcca
cggaatacccggacgtcgaactggcgcatatgtacatcgacaacgccaccatgcagctga
ttaaagatccatcacagtttgacgtcttgctgtgctccaacctgtttggcgacattctgt
ctgatgagtgcgcaatgatcactggctcaatggggatgttgccttccgccagcctgaacg
agcaaggttttggtctgtatgaaccggcgggcggctcggcacccgatatcgcaggtaaaa
atatcgccaacccgattgcacaaattctgtcgctggcgctgctgctgcgttacagcctgg
atgccgatgatgcggcttccgccattgaacgcgccattaaccgcgcattagaagaaggca
ttcgcaccggggatttagcccgtggcgctgccgccgttagtaccgatgaaatgggcgata
tcattgcccgctatgtggcagaaggggtgtaatcatggctaagacgttatacgaaaaatt
attcgacgctcacgtagtgtacgaagccgaaaacgaaaccccgctgttatatatcgaccg
ccacctggtgcatgaagtgacctcaccgcaggcgttcgatggtctgcgcgcccacggtcg
cccggtacgtcagccgggcaaaaccttcgccaccatggatcacaacgtctctacccagac
gaaagacattaatgcctgcggtgaaatggcgcgcatccagatgcaggagctgatcaaaaa
ctgcaaagaatttggcgtcgagctgtatgacctgaatcacccgtatcaggggatcgtcca
cgtaatggggccggaacagggcgtgaccttgccggggatgaccattgtctgcggcgactc
acataccgccacccacggcgcgtttggcgcactggcctttggtatcggcacttccgaagt
tgaacacgtactggcaacgcaaaccctgaaacagggccgggcgaagaccatg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search