The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|702450.3.peg.1808: Turicibacter sp. PC909

This feature in The SEED Viewer

NCBI Taxonomy Id: 702450

Current Assignment: Cysteine synthase (EC 2.5.1.47)
Translate Function Assignments



Context on contig NZ_ADMN01000078 from base 33991 to 45783 (11793 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1803 33991 34410 420 +           hypothetical protein locus|CUW_1201, protein_id|ZP_06622240.1, gi|293375980
1804 35502 34447 1056 - 36         putative membrane protein locus|CUW_1202, protein_id|ZP_06622241.1, gi|293375981
1805 36194 35499 696 - -4         probable polysaccharide deacetylase locus|CUW_1203, protein_id|ZP_06622242.1, gi|293375982
1806 37291 36191 1101 - -4     1: 9   1,2-diacylglycerol 3-glucosyltransferase (EC 2.4.1.157); diglucosyldiacylglycerol synthase (LTA membrane anchor synthesis); putative locus|CUW_1204, protein_id|ZP_06622243.1, gi|293375983
1807 37723 38934 1212 + 431         N-acyl-L-amino acid amidohydrolase (EC 3.5.1.14) locus|CUW_1205, protein_id|ZP_06622244.1, gi|293375984
1808 39011 39943 933 + 76     9: 7 3 4 6 8 11 10 12 5   Cysteine synthase (EC 2.5.1.47) gene_name|cysK, locus|CUW_1206, protein_id|ZP_06622245.1, gi|293375985
1809 40212 39991 222 - 47         hypothetical protein locus|CUW_1207, protein_id|ZP_06622246.1, gi|293375986
1810 40558 41550 993 + 345     2: 1 2   Sucrose operon repressor ScrR, LacI family locus|CUW_1208, protein_id|ZP_06622247.1, gi|293375987
1811 42048 43274 1227 + 497     1: 1   PTS system, sucrose-specific IIB component (EC 2.7.1.69) / PTS system, sucrose-specific IIC component (EC 2.7.1.69) locus|CUW_1209, protein_id|ZP_06622248.1, gi|293375988
1812 43359 44327 969 + 84     2: 1 2   Fructokinase (EC 2.7.1.4) locus|CUW_1210, protein_id|ZP_06622249.1, gi|293375989
1813 44353 45783 1431 + 25     2: 1 2   Sucrose-6-phosphate hydrolase (EC 3.2.1.B3) locus|CUW_1211, protein_id|ZP_06622250.1, gi|293375990

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Cysteine_Biosynthesis OlgaZ Cysteine synthase (EC 2.5.1.47)
Experimental_Sulfur_transfer_Archaea vcrecy Cysteine synthase (EC 2.5.1.47)
Cysteine_Biosynthesis,_MCB_432 gjo Cysteine synthase (EC 2.5.1.47)
CLO_Cysteine Lerma-Ortiz_Claudia_user Cysteine synthase (EC 2.5.1.47)
dcernst_RidA_Cysteine_phenotype Ernst_Dustin_user Cysteine synthase (EC 2.5.1.47)
dcernst_RidA_proteins Ernst_Dustin_user Cysteine synthase (EC 2.5.1.47)
Methionine_Biosynthesis rodionov Cysteine synthase (EC 2.5.1.47)
Proline Cysteine synthase (EC 2.5.1.47)
test_aaFermentation Cysteine synthase (EC 2.5.1.47)


  Protein Sequence

>fig|702450.3.peg.1808 Cysteine synthase (EC 2.5.1.47)
MEKMVHSLIELIGHTPLLELCQYNQQEGVLASIVAKLEYFNPAGSVKDRVAYSMVLAAEE
EGRLSKDSVIIEPTSGNTGIGLAFVCAARGYQLTLVMPETMSLERRHLLKALGANLVLTK
GSDGMKGAIAKANELCASTPRGIILQQFENSANPRIHKQTTALEIWDDLEGNVDVFVAGV
GTGGTITGIGEVLKQKNPDIKIIAVEPKSSPVLSGGKPGPHKIQGIGAGFVPKILNESII
DDIVQVSDEDAIATSRKLAKSEGLLVGISSGAAIFAATELAKQEAFAFKRIVVLCPDTGE
RYLSTGLYEL

MD5 = e43a3dd017f73a014dfde24198616db4


  DNA Sequence

>fig|702450.3.peg.1808 Cysteine synthase (EC 2.5.1.47)
gtggaaaaaatggtgcacagtttaattgagttaattggacatactccgttgttagaatta
tgtcagtacaatcagcaagaaggagttttggcttctattgttgctaaacttgagtatttc
aatcctgcaggaagtgtaaaagaccgcgttgcttattcgatggtattagcagcagaggag
gaagggagattaagtaaagactcagttattattgaaccaaccagtgggaatactgggatt
ggattggcttttgtttgtgcagctagagggtatcaactaactttagtcatgccagaaaca
atgagtcttgaaagacgtcatttactaaaggcactaggtgcaaatttagttttaacaaaa
ggcagtgacggaatgaagggcgctatcgctaaagcaaatgaattatgtgctagcacacct
agaggaattattttacaacagtttgaaaattcagctaatccgcgcattcataagcaaacg
accgcacttgagatttgggatgatttagaagggaatgttgatgtgtttgtagcaggggtt
gggacggggggaacgattaccggtattggtgaagttttgaaacagaaaaatcccgatatt
aaaattattgctgttgagccgaaaagttcgcctgttttatcaggaggaaaaccaggacct
cataagattcaaggaattggagcaggctttgttcctaaaattttaaatgaatcgattatc
gacgacattgtgcaagttagcgatgaggatgctattgcaacatcgcgaaagttagccaaa
tcagaaggattattagttggtatttcatcaggagcagcgatttttgcagcgactgagcta
gcaaaacaagaagcatttgcatttaaacgaattgttgttttatgtccggatacaggagag
agatatttatcaacaggtctttatgaactgtaa


  DNA with Flanking Sequence

>fig|702450.3.peg.1808 Cysteine synthase (EC 2.5.1.47)
acacatcggaaaaggttgcgctgaagcaacaggatgcgagtttaagtataacgatgattt
taatcaagttcatgagatgttaatctgtgatcgatttgaacagttatttattgaagaagc
aaagagattagggttagaagttaagttagaaggtgctaaaagcattggttcaacggatgc
cggaaatgtgagccaagtggttccaacgattcacccaacacttaaaatttgtgacgagtc
cattacgattcatacccaacactttaaagaagctgctatttcaaaagtaggagatcaagc
tatcttagatggagcattgattttagcttcgattgggcttcgattattaacagaagaatc
gttattaaatgagataaaaaatgaatttgaacaactaaaatcgttaaagagtctagtcaa
ctaaagactcttttttagtttgtttgtcataattgtaggttttttttgagtatactatag
taaaaaaagggggaattgtagtggaaaaaatggtgcacagtttaattgagttaattggac
atactccgttgttagaattatgtcagtacaatcagcaagaaggagttttggcttctattg
ttgctaaacttgagtatttcaatcctgcaggaagtgtaaaagaccgcgttgcttattcga
tggtattagcagcagaggaggaagggagattaagtaaagactcagttattattgaaccaa
ccagtgggaatactgggattggattggcttttgtttgtgcagctagagggtatcaactaa
ctttagtcatgccagaaacaatgagtcttgaaagacgtcatttactaaaggcactaggtg
caaatttagttttaacaaaaggcagtgacggaatgaagggcgctatcgctaaagcaaatg
aattatgtgctagcacacctagaggaattattttacaacagtttgaaaattcagctaatc
cgcgcattcataagcaaacgaccgcacttgagatttgggatgatttagaagggaatgttg
atgtgtttgtagcaggggttgggacggggggaacgattaccggtattggtgaagttttga
aacagaaaaatcccgatattaaaattattgctgttgagccgaaaagttcgcctgttttat
caggaggaaaaccaggacctcataagattcaaggaattggagcaggctttgttcctaaaa
ttttaaatgaatcgattatcgacgacattgtgcaagttagcgatgaggatgctattgcaa
catcgcgaaagttagccaaatcagaaggattattagttggtatttcatcaggagcagcga
tttttgcagcgactgagctagcaaaacaagaagcatttgcatttaaacgaattgttgttt
tatgtccggatacaggagagagatatttatcaacaggtctttatgaactgtaatgaaaaa
agacgactttcacgttttagtgaaaatcgtcttttttactttatagaacgttaatgacac
gacggttaattacggtagttgcttttttagggaagataatagttaaggtatcctgattga
gcctagctgtaattttattactttcaacatcgcctaaattgaatgtttgagaaaaagagc
tagattgataactttgagccccatcttgcgttgcctgatattcttgtttaactgttaaaa
ttaagagttgatcttcaaccacaagttgaatgttttctctttttaaattaggaagagtta
gcgtaaagatgtattctgaaccttgatcgatgaaagaggtgttgttcattgtattaaagc
ttgattgaaatgaattgaacatcatattttccatctgattaaaaagatcaaaaaaaccat
taccactagaaacttgattagtctgatttttaaaaggtgtcaaattaaacataaaaatgc
ctcctttttagct


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search