The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|670904.3.peg.4946: Escherichia coli 1180

This feature in The SEED Viewer

NCBI Taxonomy Id: 670904

Current Assignment: 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33)
Translate Function Assignments



Context on contig ADUQ01000082 from base 458891 to 473331 (14441 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
4940 460501 458891 1611 -       2: 3 2   Thiamin ABC transporter, transmembrane component gene_name|thiP, locus|ECOK1180_5068, protein_id|EFZ61966.1, gi|323176374
4941 461460 460477 984 - -25     2: 3 2   Thiamin ABC transporter, substrate-binding component gene_name|thiB, locus|ECOK1180_5069, protein_id|EFZ61967.1, gi|323176375
4942 463279 461624 1656 - 163         SgrR, sugar-phosphate stress, transcriptional activator of SgrS small RNA locus|ECOK1180_5070, protein_id|EFZ61968.1, gi|323176376
4943 463368 463499 132 + 88         FIG00638707: hypothetical protein locus|ECOK1180_5071, protein_id|EFZ61969.1, gi|323176377
4944 463516 464778 1263 + 16         Putative transport protein locus|ECOK1180_5072, protein_id|EFZ61970.1, gi|323176378
4945 465432 464827 606 - 48     1: 1 dlit(24561554) 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) gene_name|leuD, locus|ECOK1180_5073, protein_id|EFZ61971.1, gi|323176379
4946 466843 465443 1401 - 10     1: 1   3-isopropylmalate dehydratase large subunit (EC 4.2.1.33) gene_name|leuC, locus|ECOK1180_5074, protein_id|EFZ61972.1, gi|323176380
4947 467937 466846 1092 - 2     1: 1 dlit(9086278)
dlit(8875643)
3-isopropylmalate dehydrogenase (EC 1.1.1.85) gene_name|leuB, locus|ECOK1180_5075, protein_id|EFZ61973.1, gi|323176381
4948 469508 467937 1572 - -1     1: 1   2-isopropylmalate synthase (EC 2.3.3.13) gene_name|leuA, locus|ECOK1180_5076, protein_id|EFZ61974.1, gi|323176382
4949 470147 470269 123 + 638         hypothetical protein locus|ECOK1180_5077, protein_id|EFZ61975.1, gi|323176383
4950 470346 471290 945 + 76         Probable transcriptional activator for leuABCD operon locus|ECOK1180_5078, protein_id|EFZ61976.1, gi|323176384
4951 471607 473331 1725 + 316     1: 1   Acetolactate synthase large subunit (EC 2.2.1.6) locus|ECOK1180_5079, protein_id|EFZ61977.1, gi|323176385

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33)


  Protein Sequence

>fig|670904.3.peg.4946 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33)
MAKTLYEKLFDAHVVYEAENETPLLYIDRHLVHEVTSPQAFDGLRAHGRPVRQPGKTFAT
MDHNVSTQTKDINACGEMARIQMQELIKNCKEFGVELYDLNHPYQGIVHVMGPEQGVTLP
GMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRAKTMKIEVQGKAAPGITA
KDIVLAIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNMAIEMGAKAGLVAPDETTF
NYVKGRLHAPKGKDFDDAVAYWKTLQTDEGATFDTVVTLQAEEISPQVTWGTNPGQVISV
NDNIPDPASFADPVERASAEKALAYMGLKPGIPLTEVAIDKVFIGSCTNSRIEDLRAAAE
IAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAGFEWRLPGCSMCLAMNNDRLNP
GERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGHFADIRNIK

MD5 = 4d42f5f16566dbb9e6cade35cf385fe1


  DNA Sequence

>fig|670904.3.peg.4946 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33)
atggctaaaacgttatacgaaaaattattcgacgctcacgtagtgtacgaagccgaaaac
gaaaccccgctgttatatatcgaccgccacctggtgcatgaagtgacctcaccgcaggcg
ttcgatggtctgcgcgcccacggtcgcccggtacgtcagccgggcaaaaccttcgccact
atggatcacaacgtctctacccagacgaaagacattaatgcctgtggtgaaatggcgcgc
atccagatgcaggagctgattaaaaactgcaaagaatttggcgtcgaactgtatgacctg
aatcacccgtatcaggggatcgtccacgtaatggggccggaacagggcgtcaccttgccg
gggatgaccattgtctgcggcgactcgcataccgccacccacggcgcgtttggcgcactg
gcctttggtatcggcacttccgaagttgaacacgtactggcaacgcaaaccctgaaacag
ggccgcgcaaaaaccatgaaaattgaagtccagggcaaagccgcgccgggcattaccgca
aaagatatcgtgctggcaattatcggtaaaaccggtagcgcaggcggcaccgggcatgtg
gtggagttttgcggcgaagcaatccgtgatttaagcatggaaggtcgtatgaccctgtgc
aatatggcaatcgaaatgggcgcaaaagccggtctggttgcaccggacgaaaccaccttt
aactatgtcaaaggccgtttgcatgcgccgaaaggcaaagatttcgacgacgccgttgcc
tactggaaaaccctgcaaactgacgaaggcgcaactttcgataccgttgtcactctgcaa
gcagaagaaatttcaccgcaggtcacctggggtaccaatccaggccaggtgatttccgtg
aacgacaatattcccgatccggcttcgtttgccgatccggttgaacgcgcgtcggcagaa
aaagcgctggcctatatggggctgaaaccgggcattccgctgaccgaagtggctatcgac
aaagtgtttatcggttcctgtaccaactcgcgcattgaagatttacgcgcggcagcggag
atcgccaaagggcgaaaagtcgcgccaggcgtgcaggcactggtggttcccggctctgga
ccggtaaaagcccaggcggaagcggaaggtctggataaaatctttattgaagccggtttt
gaatggcgcttgcctggctgctcaatgtgtctggcgatgaacaacgaccgtctgaatccg
ggcgaacgttgtgcatccaccagcaaccgtaactttgaaggccgccaggggcgcggcggg
cgcacgcatctggtcagcccggcaatggctgccgctgctgctgtgaccggacatttcgcc
gacattcgcaacattaaataa


  DNA with Flanking Sequence

>fig|670904.3.peg.4946 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33)
ctgcaatcctctattttatggcgtgaaatcgtcaacgagatcgccacggaatacccggat
gtcgaactggcgcatatgtacatcgacaacgccaccatgcagctgattaaagatccatca
cagtttgacgttctgctgtgctccaacctgtttggcgacattctgtctgacgagtgcgca
atgatcactggctcgatggggatgttgccttccgccagcctgaacgagcaaggttttggt
ctgtatgaaccggcaggcggctcagcaccagatatcgcaggcaaaaacatcgccaacccg
attgcgcaaattctgtcgctggcactgctgctgcgctacagcctggatgccgatgatgcg
gcttgcgccattgaacgcgccattaaccgcgcattagaagaaggcattcgcaccggggat
ttagcccgtggcgctgccgccgttagtaccgatgaaatgggcgatatcattgcccgctat
gtggcagaaggggtgtaatcatggctaaaacgttatacgaaaaattattcgacgctcacg
tagtgtacgaagccgaaaacgaaaccccgctgttatatatcgaccgccacctggtgcatg
aagtgacctcaccgcaggcgttcgatggtctgcgcgcccacggtcgcccggtacgtcagc
cgggcaaaaccttcgccactatggatcacaacgtctctacccagacgaaagacattaatg
cctgtggtgaaatggcgcgcatccagatgcaggagctgattaaaaactgcaaagaatttg
gcgtcgaactgtatgacctgaatcacccgtatcaggggatcgtccacgtaatggggccgg
aacagggcgtcaccttgccggggatgaccattgtctgcggcgactcgcataccgccaccc
acggcgcgtttggcgcactggcctttggtatcggcacttccgaagttgaacacgtactgg
caacgcaaaccctgaaacagggccgcgcaaaaaccatgaaaattgaagtccagggcaaag
ccgcgccgggcattaccgcaaaagatatcgtgctggcaattatcggtaaaaccggtagcg
caggcggcaccgggcatgtggtggagttttgcggcgaagcaatccgtgatttaagcatgg
aaggtcgtatgaccctgtgcaatatggcaatcgaaatgggcgcaaaagccggtctggttg
caccggacgaaaccacctttaactatgtcaaaggccgtttgcatgcgccgaaaggcaaag
atttcgacgacgccgttgcctactggaaaaccctgcaaactgacgaaggcgcaactttcg
ataccgttgtcactctgcaagcagaagaaatttcaccgcaggtcacctggggtaccaatc
caggccaggtgatttccgtgaacgacaatattcccgatccggcttcgtttgccgatccgg
ttgaacgcgcgtcggcagaaaaagcgctggcctatatggggctgaaaccgggcattccgc
tgaccgaagtggctatcgacaaagtgtttatcggttcctgtaccaactcgcgcattgaag
atttacgcgcggcagcggagatcgccaaagggcgaaaagtcgcgccaggcgtgcaggcac
tggtggttcccggctctggaccggtaaaagcccaggcggaagcggaaggtctggataaaa
tctttattgaagccggttttgaatggcgcttgcctggctgctcaatgtgtctggcgatga
acaacgaccgtctgaatccgggcgaacgttgtgcatccaccagcaaccgtaactttgaag
gccgccaggggcgcggcgggcgcacgcatctggtcagcccggcaatggctgccgctgctg
ctgtgaccggacatttcgccgacattcgcaacattaaataaggagcacaccatggcagag
aaatttatcaaacacacaggcctggtggttccgctggatgccgccaatgtcgataccgat
gcaatcatcccgaaacagtttttgcagaaagtgacccgtacgggttttggcgcgcatctg
tttaacgactggcgttttctcgatgaaaaaggccaacagccaaacccggacttcgtgctg
aacttcccgcagtatcagggcgcttccattttgctggcacgagaaaacttcggctgtggc
tcctcgcgtgagcacgcgccctgggcattgaccgactacggttttaaagtggtgattgcg
ccgagttttgctgacatcttctacggcaatagctttaacaaccagctgctgccggtgaaa
ttaagcgatgcagaagtggacgaactgtttgcgctggtgaaagccaatccggggatccat
ttcgacgtggatctggaagcgcaagaggtgaaagcgggagagaaaacctatcgctttacc
a


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search