The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|666475.3.peg.278: Pseudomonas syringae pv. aesculi str. 2250

This feature in The SEED Viewer

NCBI Taxonomy Id: 666475

Current Assignment: Tryptophan synthase beta chain (EC 4.2.1.20)
Translate Function Assignments



Context on contig NZ_GG700079 from base 62 to 7383 (7322 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
276 592 62 531 -           CigR (Putative inner membrane protein)  
277 1530 718 813 - 125 9 5: 1 4 5 2 3   Tryptophan synthase alpha chain (EC 4.2.1.20)  
278 2756 1527 1230 - -4   5: 1 4 5 2 3   Tryptophan synthase beta chain (EC 4.2.1.20)  
279 2836 3792 957 + 79         HTH-type transcriptional regulator trpI  
280 4119 3793 327 - 0         FIG00953718: hypothetical protein  
281 4286 4501 216 + 166         Dodecin, a flavin storage/sequestration protein  
282 4650 4874 225 + 148         FIG00955481: hypothetical protein  
283 6015 5014 1002 - 139         Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase and related flavin-dependent oxidoreductases  
284 6228 6659 432 + 212         Peroxiredoxin OsmC  
285 6688 7011 324 + 28         FIG00955509: hypothetical protein  
286 7383 7012 372 - 0         lipoprotein, putative  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Tryptophan_synthesis_Chlora_tempo AndreiO Tryptophan synthase beta chain (EC 4.2.1.20)
Tryptophan_synthesis VeronikaV Tryptophan synthase beta chain (EC 4.2.1.20)
EC_4.2.1.1-25_Hydro-lyases gjo Tryptophan synthase beta chain (EC 4.2.1.20)
Chorismate:_Intermediate_for_synthesis_of_Tryptophan,_PAPA_antibiotics,_PABA,_3-hydroxyanthranilate_and_more. carolb Tryptophan synthase beta chain (EC 4.2.1.20)
Folate_Tryp_Chlamydiae vcrecy Tryptophan synthase beta chain (EC 4.2.1.20)


  Protein Sequence

>fig|666475.3.peg.278 Tryptophan synthase beta chain (EC 4.2.1.20)
MTQTNFRSGPDANGLFGSFGGRYVAETLMPLVLDLNREYEAAKADPEFAKEMAYFQRDYV
GRPNPLYFAERLTEFCGGAKIYFKREELNHTGAHKINNCIGQVLLAKRMGKKRLIAETGA
GMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLLGAEIVPVTSGTGTLKDAMNE
ALRDWVTNVDDTFYLIGTVAGPHPYPAMVRDFQAIIGKETKEQMQEKEGRLPDSLIACVG
GGSNAMGLFHPFLDDASVEIIGVEAGGHGVDTDKHAASLNGGVPGVLHGNRTYLLQDGDG
QITDAHSISAGLDYPGIGPEHAFLHEVKRVEYVSITDDEALDAFHQCCLLEGIIPALETA
HALAEAMKRATNLRDDHLMVVCLSGRGDKDMQTVMNHMAAAEKTQEKLV

MD5 = f077b101afd60c9e23357fc7c2c53a7a


  DNA Sequence

>fig|666475.3.peg.278 Tryptophan synthase beta chain (EC 4.2.1.20)
atgacccagaccaacttccgcagcggccccgacgccaacggcctgttcggctcattcggc
ggccgctacgtggctgaaaccctgatgccgctggtgctagacctcaaccgcgagtacgaa
gccgccaaggccgacccggagttcgccaaggaaatggcctacttccagcgcgattacgtg
ggccgtccaaacccgctgtacttcgccgagcgcctgaccgaattctgtggcggcgcgaag
atctacttcaagcgcgaagagctgaaccacaccggcgcgcacaagatcaacaactgcatc
ggccaggtattgctggccaagcgcatgggcaaaaaacgcctgattgcggaaaccggcgcg
ggcatgcacggcgttgctaccgctaccgtcgcggcgcgctttggcttgccttgcgtgatc
tacatgggcgcgaccgacatcgagcgtcagcaggccaacgtgttccgcatgaagctgctg
ggcgctgaaatcgtaccagtcacttccggcaccggcaccctgaaagatgcgatgaacgaa
gccctgcgtgactgggtgaccaacgtcgatgacaccttctacctgatcggcactgtggca
ggtccgcatccgtatccggcgatggtgcgtgatttccaggccatcatcggcaaggaaacc
aaagagcagatgcaggagaaggaaggtcgtctgccggacagcctgatcgcctgcgtgggc
ggcggctccaacgccatgggcctgttccatccgttcctcgatgacgccagcgtagaaatc
ataggcgttgaagcgggcggtcacggcgtggataccgacaagcacgcggccagcctcaat
ggcggcgtaccgggcgtactgcacggcaaccgtacctacctactccaggatggcgacggg
cagatcactgacgcgcattcgatctctgctggcctggactacccgggtatcggccctgag
cacgccttcctgcacgaagtgaaacgcgtcgagtacgtcagcatcaccgatgacgaagcg
ctggatgccttccatcaatgctgcctgctcgaaggcatcatcccggcactggaaaccgct
cacgcactggccgaagccatgaagcgggcaaccaacctgcgcgacgaccacctgatggtc
gtgtgcctgtccgggcgcggtgacaaagacatgcaaaccgtcatgaaccatatggcagcc
gccgaaaaaactcaggagaagctggtatga


  DNA with Flanking Sequence

>fig|666475.3.peg.278 Tryptophan synthase beta chain (EC 4.2.1.20)
ggcgcaggtctggcaactcggcattaagacggctcaaacgcggtatgaaccagcgcgcca
gcaggctgccggaacatcccaacacgaatggcgcgtctgcgctgcccttgctcagttcga
cacatacgccgcgcaatcgatcgaatgcttcgccactcacatcgcgtaaccgaatgcctg
catctgtgagtttcaagcctcgtccgtccttgctgaacaggcttacacccaagtgctctt
caagcactttcaattggcgactgacagcaccgtgcgtcacgttcagctgttcggcggcct
gactgacgctgccaagtcgggcggtgctttcgaaggcacgcagggcgttgaggggaggaa
ggtcgcggctcatgatctgtgagttttcctgacaggttgcagcgatcttatcggttttca
tcgagccgtgcgctggttaaagtggacccattgccgatccggctcaattcattcgcccaa
tactgcaactggagcacttcatgacccagaccaacttccgcagcggccccgacgccaacg
gcctgttcggctcattcggcggccgctacgtggctgaaaccctgatgccgctggtgctag
acctcaaccgcgagtacgaagccgccaaggccgacccggagttcgccaaggaaatggcct
acttccagcgcgattacgtgggccgtccaaacccgctgtacttcgccgagcgcctgaccg
aattctgtggcggcgcgaagatctacttcaagcgcgaagagctgaaccacaccggcgcgc
acaagatcaacaactgcatcggccaggtattgctggccaagcgcatgggcaaaaaacgcc
tgattgcggaaaccggcgcgggcatgcacggcgttgctaccgctaccgtcgcggcgcgct
ttggcttgccttgcgtgatctacatgggcgcgaccgacatcgagcgtcagcaggccaacg
tgttccgcatgaagctgctgggcgctgaaatcgtaccagtcacttccggcaccggcaccc
tgaaagatgcgatgaacgaagccctgcgtgactgggtgaccaacgtcgatgacaccttct
acctgatcggcactgtggcaggtccgcatccgtatccggcgatggtgcgtgatttccagg
ccatcatcggcaaggaaaccaaagagcagatgcaggagaaggaaggtcgtctgccggaca
gcctgatcgcctgcgtgggcggcggctccaacgccatgggcctgttccatccgttcctcg
atgacgccagcgtagaaatcataggcgttgaagcgggcggtcacggcgtggataccgaca
agcacgcggccagcctcaatggcggcgtaccgggcgtactgcacggcaaccgtacctacc
tactccaggatggcgacgggcagatcactgacgcgcattcgatctctgctggcctggact
acccgggtatcggccctgagcacgccttcctgcacgaagtgaaacgcgtcgagtacgtca
gcatcaccgatgacgaagcgctggatgccttccatcaatgctgcctgctcgaaggcatca
tcccggcactggaaaccgctcacgcactggccgaagccatgaagcgggcaaccaacctgc
gcgacgaccacctgatggtcgtgtgcctgtccgggcgcggtgacaaagacatgcaaaccg
tcatgaaccatatggcagccgccgaaaaaactcaggagaagctggtatgagccgtctcga
acaacgtttcgcccagctgaaaaccgaaggtcgtgcggcgctggtcactttcatcaccgc
cggcgacccaggctacgacacctcgctgcaagtcctgaagggcctgcctgctgcgggtgc
tgacgtgatcgagttgggcatgccgttcactgatccgatggcagacggtgtggcgattca
gctcgctacgctacgcgctctggacgcgggccagaccctgcagaaaaccctgcagatggt
cagcgaattccgtgtgaacgatcagaccacgccgattgtgctgatgggttactacaaccc
gatccaccgctttggcgtcgaagccttcgtggcgcaggcaaaagaagcgggcgtcgacgg
tctgatcatcgttgacctgcctcctgagcacgacgccgaactggcaacgcctgcacaggc
atccggtatcgacttcatccgcctgaccacgccaaccaccgacgatgcgcgcttgccgcg
tgtgttggag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|573066.3.peg.3528 Pseudomonas syringae pv. tabaci ATCC 11528 FIG   Tryptophan synthase beta chain (EC 4.2.1.20)
fig|693985.5.peg.42 Pseudomonas savastanoi pv. savastanoi NCPPB 3335 FIG   Tryptophan synthase beta chain (EC 4.2.1.20)
gi|257485568 Pseudomonas syringae pv. tabaci ATCC 11528 NCBI   tryptophan synthase subunit beta
ref|ZP_05639609.1 Pseudomonas syringae pv. tabaci ATCC 11528 RefSeq   tryptophan synthase subunit beta


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
9 fig|666475.3.peg.277 Tryptophan synthase alpha chain (EC 4.2.1.20)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search