The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|665950.3.peg.211: Lachnospiraceae bacterium 3_1_46FAA

This feature in The SEED Viewer

NCBI Taxonomy Id: 665950

Current Assignment: Cysteine synthase (EC 2.5.1.47)
Translate Function Assignments



Context on contig NZ_ACWP01000011 from base 13372 to 24767 (11396 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
205 14094 13372 723 -           FIG01031870: hypothetical protein locus|HMPREF1025_00204, protein_id|ZP_08336621.1, gi|331087695
206 14999 14157 843 - 62         hypothetical protein locus|HMPREF1025_00205, protein_id|ZP_08336622.1, gi|331087696
207 15220 16710 1491 + 220     4: 6 5 8 1   Galactose-1-phosphate uridylyltransferase (EC 2.7.7.10) locus|HMPREF1025_00206, protein_id|ZP_08336623.1, gi|331087697
208 17330 16881 450 - 170         hypothetical protein locus|HMPREF1025_00207, protein_id|ZP_08336624.1, gi|331087698
209 18148 17465 684 - 134         hypothetical protein locus|HMPREF1025_00208, protein_id|ZP_08336625.1, gi|331087699
210 18579 18148 432 - -1 4     Iron-sulfur cluster regulator IscR locus|HMPREF1025_00209, protein_id|ZP_08336626.1, gi|331087700
211 19545 18613 933 - 33   4: 4 3 7 2   Cysteine synthase (EC 2.5.1.47) locus|HMPREF1025_00210, protein_id|ZP_08336627.1, gi|331087701
212 20872 19583 1290 - 37         O-acetylhomoserine sulfhydrylase (EC 2.5.1.49) / O-succinylhomoserine sulfhydrylase (EC 2.5.1.48) locus|HMPREF1025_00211, protein_id|ZP_08336628.1, gi|331087702
213 22695 20989 1707 - 116         Oligo-1,6-glucosidase (EC 3.2.1.10) locus|HMPREF1025_00212, protein_id|ZP_08336629.1, gi|331087703
214 23086 22670 417 - -26         PTS system, mannose-specific IIA component locus|HMPREF1025_00213, protein_id|ZP_08336630.1, gi|331087704
215 23974 23120 855 - 33         putative PTS system, IID component locus|HMPREF1025_00214, protein_id|ZP_08336631.1, gi|331087705
216 24767 23967 801 - -8         phosphoenolpyruvate-dependent sugar phosphotransferase system EIIC, probable sorbose specific locus|HMPREF1025_00215, protein_id|ZP_08336632.1, gi|331087706

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Experimental_Sulfur_transfer_Archaea vcrecy Cysteine synthase (EC 2.5.1.47)
CLO_Cysteine Lerma-Ortiz_Claudia_user Cysteine synthase (EC 2.5.1.47)
Proline Cysteine synthase (EC 2.5.1.47)
test_aaFermentation Cysteine synthase (EC 2.5.1.47)


  Protein Sequence

>fig|665950.3.peg.211 Cysteine synthase (EC 2.5.1.47)
MSKIYTSADQLIGKTPLMELTHIEKEHGLKAKILAKLEYFNPAGSVKDRVAKAMIDEAEK
SGKLKKDSVIIEPTSGNTGIGLAAVAAARGYRIIIVMPETMSVERRQIMKAYGAELVLSD
GARGMKGAIEKAEELAKELPNSFIPGQFVNPANPQAHRDTTGPEIYEDTDAKVDIFVAGV
GTGGTLTGVGEYLKSKKKDVEIVAVEPKSSAVLSEGIPGAHKIQGIGAGFVPEILNTNVY
DEIIAVSDEDAFATGKMIGQREGILVGISSGAAVWAAIELAKRSENEGKTIVVLLPDTGD
RYLSTPMFAD

MD5 = 7b763ed882e1627bfc3c17b95d120859


  DNA Sequence

>fig|665950.3.peg.211 Cysteine synthase (EC 2.5.1.47)
atgtctaagatttatacatcagccgatcagttgatcggaaaaacaccacttatggaactg
acccatattgaaaaagaacatgggctgaaagcaaaaatcctggcaaaattggaatatttt
aatccggcaggctctgtaaaggatcgagtagcgaaagcgatgatagatgaggctgaaaaa
agcggaaaattaaagaaagattctgttattatcgaaccgacgagcgggaatacaggaatc
ggtcttgcggctgttgcagcggcaagaggataccgcattattatagtgatgccggaaacg
atgtcggtagaacgcaggcagatcatgaaagcatatggcgcggaactcgtgttaagtgac
ggagcgagaggaatgaaaggtgcgattgagaaggcggaagaattggcaaaagaacttccg
aacagctttattccgggtcagtttgtaaacccggcgaatccacaggctcatcgggacacg
acgggcccggagatctacgaagatacagatgcgaaggtcgatatctttgtggcgggagta
ggaacaggaggtaccctgaccggagtcggagaatatctgaaatcgaaaaagaaagacgtg
gagatcgtggctgttgagccgaagtcgtcggcagttctttcagaaggaattccgggagcg
cataaaattcagggaatcggggcaggatttgttccggaaattttaaatacaaatgtttat
gacgagattatcgcagtttcggacgaagatgcatttgccacaggaaaaatgatcggacaa
agagaaggtattcttgtcggcatttcatccggagcagcggtttgggcggcaatagagctt
gcaaaacgcagcgagaatgaaggaaagacgatcgtagtgcttctgcctgatacgggggat
cgctatttgtcgacaccgatgttcgcggattga


  DNA with Flanking Sequence

>fig|665950.3.peg.211 Cysteine synthase (EC 2.5.1.47)
tccttttgctgcatttcttttgcttcagggaacagaaacgctctcccttcgtttggaacg
tcatgccgaaaatacgaaaaaagtgatcgaatacttgaatcaccatccccttgttgaaaa
agtgaatcatccgcttatggcggatcatccggatcatgatttatacaagaagtttttcaa
aaatggcggaggttctatttttacatttgagattaagggaggaataaaagaagcacacga
gtttatcgatcatttggaaatattttctcttttggcaaatgttgcggatgtcaaaagtct
tgtgatccatccggcaacaacaacccattctcagcttaacgcacaggaactgcaggagca
gggaatccggcagaatacgatccgtctttcaatcggaacggaacatatcgacgatattat
cgcagatttggaaaagggatttgcatctgttgaaaaactgtgagaaaataaaattgaaac
atgaaaaaggagataataatatgtctaagatttatacatcagccgatcagttgatcggaa
aaacaccacttatggaactgacccatattgaaaaagaacatgggctgaaagcaaaaatcc
tggcaaaattggaatattttaatccggcaggctctgtaaaggatcgagtagcgaaagcga
tgatagatgaggctgaaaaaagcggaaaattaaagaaagattctgttattatcgaaccga
cgagcgggaatacaggaatcggtcttgcggctgttgcagcggcaagaggataccgcatta
ttatagtgatgccggaaacgatgtcggtagaacgcaggcagatcatgaaagcatatggcg
cggaactcgtgttaagtgacggagcgagaggaatgaaaggtgcgattgagaaggcggaag
aattggcaaaagaacttccgaacagctttattccgggtcagtttgtaaacccggcgaatc
cacaggctcatcgggacacgacgggcccggagatctacgaagatacagatgcgaaggtcg
atatctttgtggcgggagtaggaacaggaggtaccctgaccggagtcggagaatatctga
aatcgaaaaagaaagacgtggagatcgtggctgttgagccgaagtcgtcggcagttcttt
cagaaggaattccgggagcgcataaaattcagggaatcggggcaggatttgttccggaaa
ttttaaatacaaatgtttatgacgagattatcgcagtttcggacgaagatgcatttgcca
caggaaaaatgatcggacaaagagaaggtattcttgtcggcatttcatccggagcagcgg
tttgggcggcaatagagcttgcaaaacgcagcgagaatgaaggaaagacgatcgtagtgc
ttctgcctgatacgggggatcgctatttgtcgacaccgatgttcgcggattgactttcaa
aaagcatgagaaaggagaagtgctgaatgttgatctccacaaaaggaagatatgctttaa
gagtgatgatcgatcttgcacagaataaagagtccgggcatgtcgcgatgaaaatcgtgg
ctgcccggcaaggtatttctttgaagtatttagaaaggatcttgccggtgctgacaaaaa
acggattaatagaaggcgttcacggaaaaggcggcgggtatcgtctctgccgtgaaccaa
aagaatataaggtcggagaaatccttcgtcttacggagggaaaccttgctccggtctcat
gcctggaatgcaatgcacctgtctgtgaaagaaaagatcagtgtcacacaattggaatgt
ggactgattttcacaaaatgatcaatgattattttgatggtatcacactggaagatttga
tgcatagaaatacagagttatcagaggatgagaagtaatgaaacgaaatattgatttgaa
tgaaatatcagac


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|665950.3.peg.210 Iron-sulfur cluster regulator IscR


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search