The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|665950.3.peg.1959: Lachnospiraceae bacterium 3_1_46FAA

This feature in The SEED Viewer

NCBI Taxonomy Id: 665950

Current Assignment: Threonine dehydratase (EC 4.3.1.19)
Translate Function Assignments



Context on contig NZ_ACWP01000037 from base 41173 to 53585 (12413 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1956 41173 41859 687 +           Ribonuclease III (EC 3.1.26.3) locus|HMPREF1025_01898, protein_id|ZP_08338315.1, gi|331089416
1957 41872 45432 3561 + 12         Chromosome partition protein smc locus|HMPREF1025_01899, protein_id|ZP_08338316.1, gi|331089417
1958 45473 46411 939 + 40         Signal recognition particle receptor protein FtsY (=alpha subunit) (TC 3.A.5.1.1) locus|HMPREF1025_01900, protein_id|ZP_08338317.1, gi|331089418
1959 46408 47622 1215 + -4         Threonine dehydratase (EC 4.3.1.19) locus|HMPREF1025_01901, protein_id|ZP_08338318.1, gi|331089419
1960 48985 47804 1182 - 181     2: 2 3   Ribose-phosphate pyrophosphokinase (EC 2.7.6.1) locus|HMPREF1025_01902, protein_id|ZP_08338319.1, gi|331089420
1961 49206 50564 1359 + 220         Fe-S oxidoreductase, related to NifB/MoaA family with PDZ N-terminal domain locus|HMPREF1025_01903, protein_id|ZP_08338320.1, gi|331089421
1962 50577 51902 1326 + 12         GTP-binding protein EngA locus|HMPREF1025_01904, protein_id|ZP_08338321.1, gi|331089422
1963 51909 52568 660 + 6         Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY locus|HMPREF1025_01905, protein_id|ZP_08338322.1, gi|331089423
1964 52572 53585 1014 + 3     1: 1   Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94) locus|HMPREF1025_01906, protein_id|ZP_08338323.1, gi|331089424

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|665950.3.peg.1959 Threonine dehydratase (EC 4.3.1.19)
MMTLEKFEEASELVKKVTNSTKLVYSDYLSEQSGGKVYLKPENMQHTGAYKIRGAYYKIS
TLSDEERGRGLITASAGNHAQGVAFAAKKFGCKAVIVMPTVTPLIKVNRTKSYGAEVILH
GDVYDDAYAYACELAEKEGYTFVHPFNDIDVATGQGTIAMEIVQELPTVDYILVPIGGGG
LVSGVATLAKMLNPKIKVIGVEPAEAASMKAALAAGEVVQLESANTIADGTAVKAVGDKI
LPFVKENVDDVLLVEDDELIGAFLDMVENHKMIVENSGLLSVAALKQLDCKGKKVVCVLS
GGNMDVITMSSIVQHGLIQRDRIFSVSVLLPDKPGELVQVAQTIAEAQGNVIKLEHNQFV
STNRNAAVELRITMEAFGTEHKQEILKALEKKGYRPRLIGAKLY

MD5 = d0a276fd2453028c40dca9e82db445e1


  DNA Sequence

>fig|665950.3.peg.1959 Threonine dehydratase (EC 4.3.1.19)
atgatgacattggagaaatttgaagaagccagcgagcttgtaaaaaaagtgacgaattct
acaaagcttgtgtacagtgattatttaagcgagcaaagcggaggaaaggtttatttaaag
ccggaaaatatgcagcataccggagcatacaagatcagaggagcttattataaaatcagt
acgttatcggatgaagaacgaggcagaggactgatcacggcatcggcgggaaatcacgct
cagggcgttgcctttgccgcaaaaaaatttggctgtaaagcagttatcgttatgcctacg
gttacacctcttataaaagtgaaccgtacaaagagctacggcgcggaagtgatcctgcac
ggagatgtctatgacgatgcttatgcctatgcgtgtgagctggcagaaaaagagggatat
acgtttgtacatccgtttaatgacatagatgtagcaacaggccagggaacgatcgcaatg
gaaatcgttcaggaacttccgactgttgattacattcttgttccgatcggaggaggcgga
cttgtttccggcgttgcgacgctggctaagatgttgaatccgaaaataaaagtaatcgga
gtagaaccggcagaggcggcaagtatgaaagcggcgcttgcggcaggcgaagtcgtacaa
cttgaaagcgccaatacgatcgcggacggaacggccgtgaaagctgtaggagataaaatt
cttccctttgttaaggaaaatgtagacgacgttcttcttgtagaagatgatgaattgatc
ggcgcatttcttgacatggtagagaatcataagatgatcgttgaaaattcaggtcttttg
tcagtagcggcattgaagcagcttgactgcaaagggaaaaaggtagtctgtgtattaagc
ggcggtaatatggacgtaattacgatgtcatctattgtacagcatggattgatccaacgc
gacaggattttttctgtatctgtacttcttcctgacaaaccgggtgaacttgtccaggtg
gcgcagacaatcgcagaagctcagggaaatgtaattaagctggagcataaccaatttgta
agtacaaacagaaatgcggcagtagagcttcgtattacgatggaggcatttggaacagaa
cacaagcaggagatactaaaagcattagagaaaaaaggataccgtccgagattgatcggt
gctaaactgtattaa


  DNA with Flanking Sequence

>fig|665950.3.peg.1959 Threonine dehydratase (EC 4.3.1.19)
gctgcggcgggagaacagcttcgagaatgggcgaaccgtgccgatgcagatatgatcgga
gggcaggaaggagcagatccggcagctgtaatctatgacgcggtagctgcggcaaaagca
cgtcatgcagatgtgcttctctgtgatacggcaggaagacttcacaataaaaagaacctg
atggaggaacttaagaagatcaaccgtgtgatcgacagagagtatccggaagcttttcgg
gagacacttgtcgtattagatgcgacaacaggacaaaatgctttggcacaggcaaaagag
tttaatgaagtggcagacattacaggtgttattcttacaaagatggacggaacggcaaaa
ggtggaattgcagttgcgattcaggcagaacttggaattcccgtaaaatatatcggagtc
ggagagacgatagacgatcttcagaaatttgatgcagatgagtttgtaaacgcattgttt
tacagagaggatgaagaaaaatgatgacattggagaaatttgaagaagccagcgagcttg
taaaaaaagtgacgaattctacaaagcttgtgtacagtgattatttaagcgagcaaagcg
gaggaaaggtttatttaaagccggaaaatatgcagcataccggagcatacaagatcagag
gagcttattataaaatcagtacgttatcggatgaagaacgaggcagaggactgatcacgg
catcggcgggaaatcacgctcagggcgttgcctttgccgcaaaaaaatttggctgtaaag
cagttatcgttatgcctacggttacacctcttataaaagtgaaccgtacaaagagctacg
gcgcggaagtgatcctgcacggagatgtctatgacgatgcttatgcctatgcgtgtgagc
tggcagaaaaagagggatatacgtttgtacatccgtttaatgacatagatgtagcaacag
gccagggaacgatcgcaatggaaatcgttcaggaacttccgactgttgattacattcttg
ttccgatcggaggaggcggacttgtttccggcgttgcgacgctggctaagatgttgaatc
cgaaaataaaagtaatcggagtagaaccggcagaggcggcaagtatgaaagcggcgcttg
cggcaggcgaagtcgtacaacttgaaagcgccaatacgatcgcggacggaacggccgtga
aagctgtaggagataaaattcttccctttgttaaggaaaatgtagacgacgttcttcttg
tagaagatgatgaattgatcggcgcatttcttgacatggtagagaatcataagatgatcg
ttgaaaattcaggtcttttgtcagtagcggcattgaagcagcttgactgcaaagggaaaa
aggtagtctgtgtattaagcggcggtaatatggacgtaattacgatgtcatctattgtac
agcatggattgatccaacgcgacaggattttttctgtatctgtacttcttcctgacaaac
cgggtgaacttgtccaggtggcgcagacaatcgcagaagctcagggaaatgtaattaagc
tggagcataaccaatttgtaagtacaaacagaaatgcggcagtagagcttcgtattacga
tggaggcatttggaacagaacacaagcaggagatactaaaagcattagagaaaaaaggat
accgtccgagattgatcggtgctaaactgtattaagtttgcaaagcggtgagggatacat
ttggaaactataaaaacggtacagtctcaagataaaagaatcttttgtactgtaccgttt
ttattagctctaagtttcattgtatagcaaacaaacattcaagcgccggtcttttaaaat
caattagttacaatatattttatactgtatgcacgatcaaatctgttcgccgcgggcata
tttttcaagcagagcatgaattttgtctgtcggattcattacagcaccgattgtaatatc
gtgattaagagaatcaatgatcaaagcgagaaacttactcatatctgcttttacgaaata
tggttttttgtataattctgcaggcagatatgtaaggtttgtcgtaataactttattgat
atatcccttttcatagtattcgtcaaatttttcaaatccttcggtgaataaaccaaaagt
tgtacatacaaatacacggcctgcttttctttcttttaactgttttgcgacatca


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search