The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|658659.3.peg.1421: Erysipelotrichaceae bacterium 3_1_53

This feature in The SEED Viewer

NCBI Taxonomy Id: 658659

Current Assignment: Cysteine desulfurase (EC 2.8.1.7)
Translate Function Assignments



Context on contig NZ_GL520134 from base 334567 to 347002 (12436 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1415 335547 334567 981 -       3: 4 5 9   D-lactate dehydrogenase (EC 1.1.1.28)  
1416 337008 335593 1416 - 45         Signal recognition particle, subunit Ffh SRP54 (TC 3.A.5.1.1)  
1417 337863 337057 807 - 48         rRNA (guanine-N1-)-methyltransferase  
1418 337976 338512 537 + 112         Nitroreductase family protein  
1419 338814 338581 234 - 68         hypothetical protein  
1420 340070 338862 1209 - 47 16 3: 1 3 2   Thiamine biosynthesis protein thiI  
1421 341181 340051 1131 - -20   6: 1 3 2 8 6 7   Cysteine desulfurase (EC 2.8.1.7)  
1422 342937 341183 1755 - 1 10     Septation ring formation regulator EzrA  
1423 345099 344260 840 - 1322         hypothetical protein  
1424 345507 345193 315 - 93         Single-stranded DNA-binding protein  
1425 347002 345725 1278 - 217         FIG009210: peptidase, M16 family  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Experimental_Sulfur_transfer_Archaea vcrecy Cysteine desulfurase (EC 2.8.1.7)
tRNA_mods_Archaea Cysteine desulfurase (EC 2.8.1.7)
Test_-_Thiamin Cysteine desulfurase (EC 2.8.1.7)
Alanine_biosynthesis_HGM Cysteine desulfurase (EC 2.8.1.7)
Alanine_biosynthesis_HGM_2 Ravcheev_Dmitry_user Cysteine desulfurase (EC 2.8.1.7)
DNA/RNA_S_modification Cysteine desulfurase (EC 2.8.1.7)


  Protein Sequence

>fig|658659.3.peg.1421 Cysteine desulfurase (EC 2.8.1.7)
MIYLDYASTTPIRPEILKTYYKLLQDYYGNSDSLHDLGRESGKLMEQSRAQIAQLLHVYR
EEILFTSCASESNNAAIKGAAWQYAGRGKHLITTCVEHSSIHNAMEQLKEYFGYEVTYLP
VNASGSVDVEALKQALRKDTILVSMMLVNNETGAINPIRACADYVHANSRALFHVDGVQA
LGKVEVDLSCVDLATFSAHKIYGLKGSAILYKKKHVELVPLISGGQQENGMRAGTSNAPV
NIVFAKTLRLALEQQKEAYAHVKALNAHLRKEVSVMEDIVINSPQDGSPFILNISNLRIG
SEIMLNALNAKGFAVSAQSTCSSHSKAVSAVLLAMGLGEQRATHAIRISLSHLTTRQEVD
AFLQALKEINHDYRTK

MD5 = 3d2eb1c2295a97b94bb0ddf0e25957e8


  DNA Sequence

>fig|658659.3.peg.1421 Cysteine desulfurase (EC 2.8.1.7)
atgatttatctggattatgcatctaccacccctattcgtccggagattttaaaaacatat
tataagctgctgcaggactattatggcaacagcgattctctgcatgatttgggcagagaa
tcaggaaagcttatggaacaaagccgtgcacaaattgcacagcttttgcatgtttacagg
gaggagattttatttacctcctgtgccagtgaatcaaacaatgcagcaatcaagggagct
gcatggcagtatgcagggcgtggtaagcatctgattaccacctgtgttgagcattccagc
attcacaatgcgatggagcagctaaaggaatatttcggctatgaggtaacctatctgcca
gtaaatgcatcaggtagtgtggatgtggaagcactgaagcaggctttgcgaaaggatacg
attctggtatccatgatgctcgtaaacaatgagacaggcgcaatcaatccgattcgtgcc
tgtgcagactacgtgcatgccaattccagagccctttttcatgtggatggcgtacaggcc
ctaggtaaggtggaggttgatttatcctgtgtcgatctggcaaccttttcggcgcataaa
atctatggcctgaagggaagcgccatcttgtataaaaagaagcatgtggagctggtacct
ctcattagtggcggacagcaggaaaacggcatgcgtgcgggcaccagcaatgctcctgtc
aatatcgtttttgccaaaacgctgcgtcttgcgctggaacagcagaaggaagcctatgcg
catgtgaaagcgttgaatgcgcatttgcggaaagaagtatctgtcatggaggatatcgta
atcaattctccacaggatggcagtccgttcatacttaatatatcaaatctgcgcatcggc
agtgaaatcatgctgaatgcattgaatgcaaaaggctttgcggtatctgcacagagcacc
tgttcctcacacagcaaggctgtctcagcagtgcttctggcaatgggcctgggggaacaa
agagctacccatgccatacgtatatccctgtcgcatctgacaaccagacaggaggtcgat
gcctttttacaggctttaaaggagatcaatcatgactatcgaacaaaataa


  DNA with Flanking Sequence

>fig|658659.3.peg.1421 Cysteine desulfurase (EC 2.8.1.7)
gctggacaatgcctgcagtgatgaagaacgggctaaaaagcagctgatcaagctgcagct
catcgtaaatgaaatccgggtgaagatgtccaagcacagactgccaagtgtttcccagaa
gtatgaggatgatttacataagggggaaatcatgattaaggatattcaggtgattctgga
taattcaccacttgatgtcaaacgcctgaatgcggagctgcgcagtgctattgattatat
ttataccctgtataacagcgtgaacaatctggtgggaatggcaatcatggtggaaaatac
gattgtatttggaaaccggtatcgttcctcctttccggatattgacagtgagctgacaag
agcagagctgtgcttccggaacggacagtatacaaaggctttgaaaatcggtattcaatg
tattgaaaagatgcatccgggagcctatgaaaagctcattaacaaaaaggatccaagcat
cctgaatacgggggagtaatatgatttatctggattatgcatctaccacccctattcgtc
cggagattttaaaaacatattataagctgctgcaggactattatggcaacagcgattctc
tgcatgatttgggcagagaatcaggaaagcttatggaacaaagccgtgcacaaattgcac
agcttttgcatgtttacagggaggagattttatttacctcctgtgccagtgaatcaaaca
atgcagcaatcaagggagctgcatggcagtatgcagggcgtggtaagcatctgattacca
cctgtgttgagcattccagcattcacaatgcgatggagcagctaaaggaatatttcggct
atgaggtaacctatctgccagtaaatgcatcaggtagtgtggatgtggaagcactgaagc
aggctttgcgaaaggatacgattctggtatccatgatgctcgtaaacaatgagacaggcg
caatcaatccgattcgtgcctgtgcagactacgtgcatgccaattccagagccctttttc
atgtggatggcgtacaggccctaggtaaggtggaggttgatttatcctgtgtcgatctgg
caaccttttcggcgcataaaatctatggcctgaagggaagcgccatcttgtataaaaaga
agcatgtggagctggtacctctcattagtggcggacagcaggaaaacggcatgcgtgcgg
gcaccagcaatgctcctgtcaatatcgtttttgccaaaacgctgcgtcttgcgctggaac
agcagaaggaagcctatgcgcatgtgaaagcgttgaatgcgcatttgcggaaagaagtat
ctgtcatggaggatatcgtaatcaattctccacaggatggcagtccgttcatacttaata
tatcaaatctgcgcatcggcagtgaaatcatgctgaatgcattgaatgcaaaaggctttg
cggtatctgcacagagcacctgttcctcacacagcaaggctgtctcagcagtgcttctgg
caatgggcctgggggaacaaagagctacccatgccatacgtatatccctgtcgcatctga
caaccagacaggaggtcgatgcctttttacaggctttaaaggagatcaatcatgactatc
gaacaaaataagattgtatataaccatattcttgtgcgctttggggagctgtccaccaag
ggaaagaataaaaaagattttatcaaacggctgttaacaaatgtaaagaatgcgctgcgt
gattatgacaaactgagctatgagcgtacgcatgaccgtttgtatatcctgctgaacggc
gagaatcctcacgctatcagtgagcatttgcagaaggtatttggtatttcctccttttcc
tttgcgattcgtgtggataccgatattgaggctatgaagcagacggcgctgcaggtggcg
aaggaaagtgatgcatccacctttaaaattgaatcccgcagaagtcataagctgtttccc
atgatttctgatgaaatcaaccgtgcggttgccggcgaaattttgcgcaacaccgagctg
aaggtcaatgtcagagagccgcagctgcgtattcagattgaggtgcatcaggacgataca
tatatcatgaccggacggattcagggagccg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
16 fig|658659.3.peg.1420 Thiamine biosynthesis protein thiI
10 fig|658659.3.peg.1422 Septation ring formation regulator EzrA


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search