The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|649764.3.peg.1527: Slackia exigua ATCC 700122

This feature in The SEED Viewer

NCBI Taxonomy Id: 649764

Current Assignment: Cysteine synthase (EC 2.5.1.47)
Translate Function Assignments



Context on contig NZ_GG700631 from base 353882 to 367012 (13131 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1521 355324 353882 1443 -           hypothetical protein  
1522 356077 355544 534 - 219     4: 21 13 10 19   Adenine phosphoribosyltransferase (EC 2.4.2.7)  
1523 356460 356332 129 - 254         hypothetical protein  
1524 356618 357916 1299 + 157     3: 12 6 3   O-acetylhomoserine sulfhydrylase (EC 2.5.1.49) / O-succinylhomoserine sulfhydrylase (EC 2.5.1.48)  
1525 359087 357999 1089 - 82     1: 16   tRNA-specific 2-thiouridylase MnmA  
1526 359215 359084 132 - -4         hypothetical protein  
1527 360245 359316 930 - 100     11: 5 7 11 3 8 18 22 14 17 20 9   Cysteine synthase (EC 2.5.1.47)  
1528 360453 360884 432 + 207     2: 15 4   Iron-sulfur cluster regulator IscR  
1529 361363 361025 339 - 140         hypothetical protein  
1530 361545 361724 180 + 181         hypothetical protein  
1531 363898 362609 1290 - 884         hypothetical protein  
1532 364752 364108 645 - 209     2: 1 2   Ribonucleotide reductase of class III (anaerobic), activating protein (EC 1.97.1.4)  
1533 367012 364790 2223 - 37     2: 1 2   Ribonucleotide reductase of class III (anaerobic), large subunit (EC 1.17.4.2)  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Cysteine_Biosynthesis OlgaZ Cysteine synthase (EC 2.5.1.47)
Experimental_Sulfur_transfer_Archaea vcrecy Cysteine synthase (EC 2.5.1.47)
Cysteine_Biosynthesis,_MCB_432 gjo Cysteine synthase (EC 2.5.1.47)
CLO_Cysteine Lerma-Ortiz_Claudia_user Cysteine synthase (EC 2.5.1.47)
dcernst_RidA_Cysteine_phenotype Ernst_Dustin_user Cysteine synthase (EC 2.5.1.47)
dcernst_RidA_proteins Ernst_Dustin_user Cysteine synthase (EC 2.5.1.47)
Methionine_Biosynthesis rodionov Cysteine synthase (EC 2.5.1.47)
Cysteine_biosynthesis_HGM_New Kutt_Laura_user Cysteine synthase (EC 2.5.1.47)
Proline Cysteine synthase (EC 2.5.1.47)
Fermentation_of_amino_acids_HGM_2 Cysteine synthase (EC 2.5.1.47)
Cysteine_biosynthesis_PanGenomes Acharya_Geeta_user Cysteine synthase (EC 2.5.1.47)


  Protein Sequence

>fig|649764.3.peg.1527 Cysteine synthase (EC 2.5.1.47)
MTVYTSIDQLIGNTPLLELKGIEAKEGLKARVLGKLEYFNPAGSVKDRIAKAMLDDAEAR
GKIGPGATIIEPTSGNTGVGLASVAAARGYKVVITMPETMSVERRLLMKAYGAQLVLTDG
SKGMKGAIAKAQELADQMPNSFLAGQFVNPANPAVHKATTGPEIWADTDGTVDIFVAGVG
TGGTVTGTGAYLKEQNSAVKVVAVEPASSPVLSEGTSGSHKIQGIGAGFVPDVLDTSVYD
EVVKVENDDAFETGREIGRLEGVLVGISSGAAVWAAVELAKRPENEGKTIVALLPDTGER
YLSTPLFAE

MD5 = 368f161d55b1ef90dbefcb639d653b77


  DNA Sequence

>fig|649764.3.peg.1527 Cysteine synthase (EC 2.5.1.47)
atgaccgtctacacatccattgaccagctcataggcaatacgccgctcctcgagctcaag
ggcatcgaagcgaaggagggcctgaaggcccgcgtgctcggcaagctcgagtatttcaat
cctgccggttcggtcaaagaccgcatcgccaaagccatgctcgacgatgccgaggcgcgc
ggcaagatcggcccgggcgccacgatcatcgaacccacctccggcaataccggcgtcggc
ctcgcttccgtggccgccgcgcgcgggtacaaggtcgtcatcacgatgcccgagaccatg
agcgtcgagcgtcgcctgctcatgaaggcctacggggcgcagctcgtcctgaccgacggc
tcgaagggcatgaagggcgccatcgcgaaggcgcaggaactcgccgaccagatgccgaac
agctttttggccggccagttcgtcaaccctgcgaatccggcggtccataaggccacgacc
ggtcctgaaatctgggcggacaccgacggcacggtcgacatcttcgtcgcaggcgtcggc
accggcggcacggtgacgggcacgggcgcgtacctcaaggagcagaattccgccgtcaag
gtcgtcgccgtcgaaccggcaagctctccggtcctgtccgaaggcacgtccggctcccat
aagatccagggtatcggcgcgggcttcgtgcccgatgtgctggacacgtccgtctacgac
gaggtcgtcaaggtcgaaaacgacgacgccttcgaaaccgggcgcgagatcggccgcctg
gaaggcgtgctcgtgggcatatcctcgggcgctgcggtctgggccgccgtcgagcttgcg
aagcgtccggaaaacgagggcaagaccatcgtcgcgctccttcccgatacgggcgagcgg
tacctgtccacgccgctgttcgccgaatag


  DNA with Flanking Sequence

>fig|649764.3.peg.1527 Cysteine synthase (EC 2.5.1.47)
gattcgtcttcgtcgaggcagggaacctgggcaagcccgccctcggtcaggcgcaggatc
tcgcctacggtgtacaacgagggatcgcgcgtcaggcgatatccgccgcccttgccacgc
agtccgacgagcaggccgttcttcacgagcaccttgaggatgctttcgaggtatttttcc
gaaatttcctgacgccgggcgatctccttcagaggcgtgtacgaacaggacatgtgttcg
gccaggtcgaccatgacgcgcagggcgtagcggcctttcgttgaaatcatcatatgctct
gcctcttctctcaattccattacccataatatcaccaggttgtatgtatttacagggaag
cgcatcatgaaccccgtgccgtcgtcttgactttattgctcgaagtaggtttaatccctc
taaacctacttagtagatagggttatgcagtgacgcatcttcggcacgacccgtctgcgt
gtcctcgaaaggaagctgccatgaccgtctacacatccattgaccagctcataggcaata
cgccgctcctcgagctcaagggcatcgaagcgaaggagggcctgaaggcccgcgtgctcg
gcaagctcgagtatttcaatcctgccggttcggtcaaagaccgcatcgccaaagccatgc
tcgacgatgccgaggcgcgcggcaagatcggcccgggcgccacgatcatcgaacccacct
ccggcaataccggcgtcggcctcgcttccgtggccgccgcgcgcgggtacaaggtcgtca
tcacgatgcccgagaccatgagcgtcgagcgtcgcctgctcatgaaggcctacggggcgc
agctcgtcctgaccgacggctcgaagggcatgaagggcgccatcgcgaaggcgcaggaac
tcgccgaccagatgccgaacagctttttggccggccagttcgtcaaccctgcgaatccgg
cggtccataaggccacgaccggtcctgaaatctgggcggacaccgacggcacggtcgaca
tcttcgtcgcaggcgtcggcaccggcggcacggtgacgggcacgggcgcgtacctcaagg
agcagaattccgccgtcaaggtcgtcgccgtcgaaccggcaagctctccggtcctgtccg
aaggcacgtccggctcccataagatccagggtatcggcgcgggcttcgtgcccgatgtgc
tggacacgtccgtctacgacgaggtcgtcaaggtcgaaaacgacgacgccttcgaaaccg
ggcgcgagatcggccgcctggaaggcgtgctcgtgggcatatcctcgggcgctgcggtct
gggccgccgtcgagcttgcgaagcgtccggaaaacgagggcaagaccatcgtcgcgctcc
ttcccgatacgggcgagcggtacctgtccacgccgctgttcgccgaatagggaggtattc
gggtgttcggcggattatgacgggcgttccgcacgattcccgcatggtttgatgcgcgga
atgcgatgcggcagggaaaggaggcttcacatgatgatatgcgtggatcatgcggcttcg
atgccgccgcgtcctgaggtgcgcgtagccttcgcgtgcgccctcgaggcatcatggggc
aatccgagcagcctgcccggggaaggagcggttcgccgatgacgaagcgcgtcatggtgg
gcatgagcggcggcgtcgattcgagcgttaccgcatacgtgctcaaacagcagggatacg
aagtcatcggtgccacgatgcgcctgcatggcagcgacctgcccggccgcgacgcgcgct
cgtgcgcgagccgtacctgttgcagcctggacgacgtcgaggatgccaaaagcgtcgcgc
gccgtttgggcatagcccatcgcacgatcgatttcaccgatcgtttcgaagacgccgtca
tcaagccgtt


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search