The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|585152.3.peg.2331: Staphylococcus aureus subsp. aureus D139

This feature in The SEED Viewer

NCBI Taxonomy Id: 585152

Current Assignment: putative esterase
Translate Function Assignments



Context on contig NZ_GG730182 from base 43342 to 55395 (12054 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2325 43342 43950 609 +       1: 15   DNA-3-methyladenine glycosylase II (EC 3.2.2.21)  
2326 44287 45495 1209 + 336         Sodium/glutamate symport protein  
2327 46592 45543 1050 - 47     4: 3 10 12 16   Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)  
2328 47570 46623 948 - 30     1: 9   Magnesium and cobalt transport protein CorA  
2329 47667 48158 492 + 96     7: 14 6 4 8 5 2 13   3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35)  
2330 48155 48574 420 + -4         FIG01107838: hypothetical protein  
2331 49539 48682 858 - 107     1: 7   putative esterase  
2332 49810 50448 639 + 270         FIG01108339: hypothetical protein  
2333 52626 50695 1932 - 246     1: 1   Membrane component of multidrug resistance system  
2334 53286 52639 648 - 12     1: 1   Multidrug resistance protein [function not yet clear]  
2335 53407 53961 555 + 120     1: 1   TetR family regulatory protein of MDR cluster  
2336 55395 54187 1209 - 225     1: 11   Teicoplanin resistance associated membrane protein TcaB  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Alpha-Amylase_locus_in_Streptocococcus RamyA putative esterase


  Protein Sequence

>fig|585152.3.peg.2331 putative esterase
MFKNDQDVERFFYKREIENRKKHKQPSTLNVKANLEKLSLDDMQVFRFNFRHQIDKKILY
IHGGFNALQPSPFHWRLLDKITLSTLYEVVLPIYPKTPEFHIDDTFQAIQRVYDQLVSEV
GHQNVVVMGDGSGGALALSFVQSLLDNQQPLPNKLYLISPILDATLSNKDISDALIEQDA
VLSQFGVNEIMKKWANGLPLTDKRISPINGTIEGLPPVYMFGGGREMTHPDMKLFEQMML
QHHQYIEFYDYPKMVHDFPIYPIRQSHKAIKQIAKSIDEDVTQNN

MD5 = 7ce6f798441f56a0586d5bd092ee77af


  DNA Sequence

>fig|585152.3.peg.2331 putative esterase
atgtttaaaaatgatcaagatgttgaaagatttttttataaaagagaaattgaaaataga
aaaaaacataagcagccttcaacattaaatgttaaagcaaatttagaaaaattatcatta
gatgatatgcaagtctttcgctttaatttcagacatcaaattgataagaaaattttatat
attcacggtggattcaatgcactacaaccatcaccgttccattggagattgttggataaa
atcactttaagtacattatatgaggttgtactgcctatctatccaaagacaccagagttt
catattgacgacactttccaagcgatacaacgtgtttatgatcaattagtatctgaagta
ggccatcaaaatgtcgtagtcatgggtgatggttcaggtggtgcactggcattatccttt
gtacaatctcttttagacaatcaacagccattaccgaataaattgtatttaatctcacca
attttagatgcaacactatctaataaagatatttcggacgctttaatcgaacaagatgcg
gttctaagtcagtttggtgtcaatgagattatgaaaaaatgggcgaatggcctaccatta
acagataagcgcatatcgccaattaatggcacaatagaaggattaccaccagtttatatg
tttggtggtggacgtgaaatgacacatcctgatatgaagctgttcgaacaaatgatgttg
caacatcatcaatacattgagttttatgattatcctaagatggtacatgattttccaatt
tatccaattagacaatcacataaagctattaaacaaattgccaaatcgatagatgaggat
gtaacacaaaataactaa


  DNA with Flanking Sequence

>fig|585152.3.peg.2331 putative esterase
ttaaaatttttaatgccatcaaaatctacagattctttggtgaagacaatattaaaaatg
ggttgtttccacatactgtatccagcgattgcggttaatataacaacaatgatttgaata
atcatgcttaccaatgaacgttttttcttaccatatcgcttaccacgatgaatattcggt
tgttgaaatgtctcatcaaatggttctaatcgttgatttggatttgtcatgcaaggcacc
tccgtataaagttcttttctttacttatcaatatgtctagttgtctgttataatgatgaa
aaatcactgttcaattgtagtcttaaatttgaaagtgaaaaagaaaatatcttctacatt
atatactttttttggcaaagaatgtaggggatagacaatcattggatacataaaatatat
aaaggtaggttaagacattgattagaaaccgtgttatgaatagcgttgtcaataaatatt
tgcttcacaatcgctcgattatgtttaaaaatgatcaagatgttgaaagatttttttata
aaagagaaattgaaaatagaaaaaaacataagcagccttcaacattaaatgttaaagcaa
atttagaaaaattatcattagatgatatgcaagtctttcgctttaatttcagacatcaaa
ttgataagaaaattttatatattcacggtggattcaatgcactacaaccatcaccgttcc
attggagattgttggataaaatcactttaagtacattatatgaggttgtactgcctatct
atccaaagacaccagagtttcatattgacgacactttccaagcgatacaacgtgtttatg
atcaattagtatctgaagtaggccatcaaaatgtcgtagtcatgggtgatggttcaggtg
gtgcactggcattatcctttgtacaatctcttttagacaatcaacagccattaccgaata
aattgtatttaatctcaccaattttagatgcaacactatctaataaagatatttcggacg
ctttaatcgaacaagatgcggttctaagtcagtttggtgtcaatgagattatgaaaaaat
gggcgaatggcctaccattaacagataagcgcatatcgccaattaatggcacaatagaag
gattaccaccagtttatatgtttggtggtggacgtgaaatgacacatcctgatatgaagc
tgttcgaacaaatgatgttgcaacatcatcaatacattgagttttatgattatcctaaga
tggtacatgattttccaatttatccaattagacaatcacataaagctattaaacaaattg
ccaaatcgatagatgaggatgtaacacaaaataactaataacatacaattgacccagtta
cgatttcatggaagatgatatttgacatgaaaacgcaattgggttttgtttttgaaaata
tagcaaggattatatagactaattgttaatgcgcttctgagtgaaaatcaccaataagtg
tattgatatgcgtgatgataaagtattgccctttaatttgataaaattgatctaaaaaat
tatcgaattgacgtggaatatcactaagttctgcaaaattagctgttttatcataattgc
gatgagcaacctcattttgaaatttatcataatgttctaagaaatgttgatcttcaagct
gttgttccacaatagtcataatattatcgatggcttgcttttgtccttgaacataagcca
tatgcacgccacgcttaagtagctgatttgctggtccgttaatgtataaccctttttgtg
catttaattctgttaattcaaacttaacatcatctaataaatctagtaattcgatatg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0008152       P:metabolic process
GO:0016787       F:hydrolase activity
cmr|NT05SA2366 Staphylococcus aureus NCTC 8325     esterase/lipase/thioesterase
fig|158878.14.peg.2433 Staphylococcus aureus subsp. aureus Mu50 FIG   putative esterase
fig|158879.11.peg.2324 Staphylococcus aureus subsp. aureus N315 FIG   putative esterase
fig|273036.6.peg.2349 Staphylococcus aureus RF122 FIG   putative esterase
fig|282458.4.peg.2457 Staphylococcus aureus subsp. aureus MRSA252 FIG   putative esterase
fig|426430.8.peg.2449 Staphylococcus aureus subsp. aureus str. Newman FIG   putative esterase
fig|450394.6.peg.1851 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   putative esterase
fig|451515.3.peg.2452 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   putative esterase
fig|451516.9.peg.2441 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   putative esterase
fig|452948.4.peg.1207 Staphylococcus aureus 930918-3 FIG   putative esterase
fig|455227.3.peg.1841 Staphylococcus aureus D30 FIG   putative esterase
fig|546342.3.peg.1032 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   putative esterase
fig|548473.3.peg.240 Staphylococcus aureus subsp. aureus TCH60 FIG   putative esterase
fig|548474.3.peg.526 Staphylococcus aureus subsp. aureus TCH130 FIG   putative esterase
fig|553565.3.peg.2051 Staphylococcus aureus A5937 FIG   putative esterase
fig|553571.3.peg.1575 Staphylococcus aureus A6300 FIG   putative esterase
fig|553573.3.peg.743 Staphylococcus aureus A8115 FIG   putative esterase
fig|553577.3.peg.179 Staphylococcus aureus A8796 FIG   putative esterase
fig|553580.3.peg.181 Staphylococcus aureus A8819 FIG   putative esterase
fig|553581.3.peg.2541 Staphylococcus aureus A9299 FIG   putative esterase
fig|553583.3.peg.1244 Staphylococcus aureus A9635 FIG   putative esterase
fig|553588.3.peg.2631 Staphylococcus aureus A9719 FIG   putative esterase
fig|553590.4.peg.955 Staphylococcus aureus A9754 FIG   putative esterase
fig|553592.3.peg.991 Staphylococcus aureus A9763 FIG   putative esterase
fig|553594.3.peg.2107 Staphylococcus aureus A9765 FIG   putative esterase
fig|553601.3.peg.581 Staphylococcus aureus A10102 FIG   putative esterase
fig|585143.3.peg.826 Staphylococcus aureus subsp. aureus 55/2053 FIG   putative esterase
fig|585145.3.peg.624 Staphylococcus aureus subsp. aureus 65-1322 FIG   putative esterase
fig|585146.3.peg.195 Staphylococcus aureus subsp. aureus 68-397 FIG   putative esterase
fig|585147.3.peg.1908 Staphylococcus aureus subsp. aureus A017934/97 FIG   putative esterase
fig|585148.3.peg.2134 Staphylococcus aureus subsp. aureus Btn1260 FIG   putative esterase
fig|585149.6.peg.2526 Staphylococcus aureus subsp. aureus C101 FIG   putative esterase
fig|585150.3.peg.743 Staphylococcus aureus subsp. aureus C160 FIG   putative esterase
fig|585151.3.peg.2336 Staphylococcus aureus subsp. aureus C427 FIG   putative esterase
fig|585153.3.peg.624 Staphylococcus aureus subsp. aureus E1410 FIG   putative esterase
fig|585154.3.peg.2415 Staphylococcus aureus subsp. aureus EMRSA16 FIG   putative esterase
fig|585155.3.peg.896 Staphylococcus aureus subsp. aureus H19 FIG   putative esterase
fig|585156.3.peg.1906 Staphylococcus aureus subsp. aureus M1015 FIG   putative esterase
fig|585157.3.peg.2023 Staphylococcus aureus subsp. aureus M809 FIG   putative esterase
fig|585158.3.peg.403 Staphylococcus aureus subsp. aureus M876 FIG   putative esterase
fig|585160.3.peg.2166 Staphylococcus aureus subsp. aureus WBG10049 FIG   putative esterase
fig|585891.3.peg.2429 Staphylococcus aureus subsp. aureus Mu50-omega FIG   putative esterase
fig|644279.4.peg.2493 Staphylococcus aureus subsp. aureus 132 FIG   putative esterase
fig|680649.3.peg.772 Staphylococcus aureus subsp. aureus MR1 FIG   putative esterase
fig|681288.4.peg.2378 Staphylococcus aureus subsp. aureus ED98 FIG   putative esterase
fig|703339.3.peg.2339 Staphylococcus aureus 04-02981 FIG   putative esterase
fig|93061.5.peg.2376 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   putative esterase
gb|EEJ62617.1 Staphylococcus aureus subsp. aureus TCH60     esterase
gb|EES96660.1 Staphylococcus aureus subsp. aureus TCH130     esterase
gi|227852819 Staphylococcus aureus subsp. aureus TCH60 NCBI   esterase
gi|227898873 Staphylococcus aureus subsp. aureus TCH60 NCBI   esterase
gi|253727931 Staphylococcus aureus subsp. aureus TCH130 NCBI   esterase
gi|253734236 Staphylococcus aureus subsp. aureus TCH130 NCBI   esterase
ref|ZP_04016678.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   esterase
ref|ZP_04868401.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   esterase
tr|C2G8J5 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   Esterase
tr|C5Q2N2 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Esterase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search