The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|585151.3.peg.1732: Staphylococcus aureus subsp. aureus C427

This feature in The SEED Viewer

NCBI Taxonomy Id: 585151

Current Assignment: Hypothetical SAV0788 homolog in superantigen-encoding pathogenicity islands SaPI
Translate Function Assignments



Context on contig NZ_GG730154 from base 2169 to 12064 (9896 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1725 2810 2169 642 -           Hypothetical SAV0794 homolog in superantigen-encoding pathogenicity islands SaPI  
1726 3091 2807 285 - -4         Hypothetical SAV0793 homolog in superantigen-encoding pathogenicity islands SaPI  
1727 3455 3093 363 - 1         Hypothetical SAV0792 homolog in superantigen-encoding pathogenicity islands SaPI  
1728 5210 3741 1470 - 285         Hypothetical SAV0791 homolog in superantigen-encoding pathogenicity islands SaPI  
1729 6096 5227 870 - 16         Hypothetical SAV0790 homolog in superantigen-encoding pathogenicity islands SaPI  
1730 6480 6160 321 - 63         Hypothetical SAV0789 homolog in superantigen-encoding pathogenicity islands SaPI  
1731 6840 6481 360 - 0         FIG01109448: hypothetical protein  
1732 7054 6842 213 - 1         Hypothetical SAV0788 homolog in superantigen-encoding pathogenicity islands SaPI  
1733 7193 7047 147 - -8         Hypothetical SAV0787 homolog in superantigen-encoding pathogenicity islands SaPI  
1734 7507 7190 318 - -4         Hypothetical SAV0787 homolog in superantigen-encoding pathogenicity islands SaPI  
1735 8162 7521 642 - 13         Phage antirepressor protein  
1736 8378 8166 213 - 3         Hypothetical SAV2026 homolog in superantigen-encoding pathogenicity islands SaPI  
1737 8532 9194 663 + 153         putative transcriptional regulator  
1738 9207 10379 1173 + 12         Integrase, superantigen-encoding pathogenicity islands SaPI  
1739 12064 10448 1617 - 68     3: 2 3 1   Heat shock protein 60 kDa family chaperone GroEL  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|585151.3.peg.1732 Hypothetical SAV0788 homolog in superantigen-encoding pathogenicity islands SaPI
MNNEQKEVIKDIYSSLESVANNKSEVYIHEFKCGEKERTETVNREQHLQAIIEWTLQQIE
NNFEFEEENE

MD5 = 0178180573c2e67830a9f9d0047f7a2a


  DNA Sequence

>fig|585151.3.peg.1732 Hypothetical SAV0788 homolog in superantigen-encoding pathogenicity islands SaPI
atgaataatgaacaaaaagaagtgattaaagatatttatagcagtttggaatcagtagct
aataacaaatcagaggtatacatccatgaatttaaatgtggtgagaaagaacggacagag
acagtaaaccgtgagcaacacttacaagcgattatcgagtggacattgcaacaaatagaa
aataattttgaatttgaagaggagaatgaataa


  DNA with Flanking Sequence

>fig|585151.3.peg.1732 Hypothetical SAV0788 homolog in superantigen-encoding pathogenicity islands SaPI
tgataagtacaacaataagcaacaaatggcgtaagggggcttaactaatgttcaacatta
atatagacgaacaagaagcacgcgagttattagaacaagctattaatgtacgtgtagaag
aattagcgaaagagaaatatttcatgacttacaaagagttgtctaactatctgaatttaa
gtaagcctactattgaagaattacttattaataatggcatgaaatattatatggtcggat
ctacgtacagattcaaaaagtttgatgtagatgaattcatggaacagcttactgctcata
tgaatatccagaataacgactttaaacaagtcaatatcaaaaagttattggaggcaaggc
aatgaaaatgtatttagcttatatctgcttagtttcattgttaacaattttattactagc
aatatctaacatgtatgtcgcttttagcgtttatgcttggctaataactttaggatgtaa
tttaacaggaggattagaaaatgaataatgaacaaaaagaagtgattaaagatatttata
gcagtttggaatcagtagctaataacaaatcagaggtatacatccatgaatttaaatgtg
gtgagaaagaacggacagagacagtaaaccgtgagcaacacttacaagcgattatcgagt
ggacattgcaacaaatagaaaataattttgaatttgaagaggagaatgaataagatgaat
aaattaactaaacaggaatacaaaaacattgaaaataaattgaattacgatcatatggta
aatggtaaaaaacgcactaataaaataaacaaactcttacaaagagaacatgatagagat
gcttcaattattaaaagtgaataccctagactaagtgatagtgagatatcagaagttatt
gtggattatagaacttataaggagcttgtaatagcaacagaaacttttgttgatttccct
ataaattatgaggattcaaatgtatgtcagttcattactaaggaagatattgaagatctg
aaatcagcaattgaagaaatgacaagtttcgttgaaaatttggaggaattataaatgaat
tgggaaattaaagatttaatgtgtgacattgaagtgataaaacaaaaaattaatgatgta
gctaccaaacatgcttggtttgttgaagatagatttgtaaaaaatgaattagaaacaaaa
cgggaacatatta


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search