The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|575615.3.peg.1326: Prevotella sp. oral taxon 317 str. F0108

This feature in The SEED Viewer

NCBI Taxonomy Id: 575615

Current Assignment: Cysteine synthase (EC 2.5.1.47)
Translate Function Assignments



Context on contig NZ_GG740072 from base 125308 to 137346 (12039 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1320 126267 125308 960 -           putative ABC transporter ATP-binding protein  
1321 126239 126382 144 + -29         FIG00939165: hypothetical protein  
1322 127434 126616 819 - 233         putative ABC transporter ATP-binding protein  
1323 127519 127632 114 + 84         hypothetical protein  
1324 127648 128670 1023 + 15     5: 6 5 13 8 9   Permease of the drug/metabolite transporter (DMT) superfamily  
1325 129729 128764 966 - 93     1: 11   ADP-ribosylglycohydrolase  
1326 130845 131792 948 + 1115     6: 4 3 7 10 12 2   Cysteine synthase (EC 2.5.1.47)  
1327 133503 132049 1455 - 256     1: 1   Aminopeptidase C (EC 3.4.22.40)  
1328 133892 135907 2016 + 388         putative TonB-dependent receptor  
1329 136464 135916 549 - 8         Ribosomal RNA small subunit methyltransferase D (EC 2.1.1.-)  
1330 137346 136513 834 - 48         FIG00939848: hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Cysteine_Biosynthesis OlgaZ Cysteine synthase (EC 2.5.1.47)
Experimental_Sulfur_transfer_Archaea vcrecy Cysteine synthase (EC 2.5.1.47)
CLO_Cysteine Lerma-Ortiz_Claudia_user Cysteine synthase (EC 2.5.1.47)
Methionine_Biosynthesis rodionov Cysteine synthase (EC 2.5.1.47)
Proline Cysteine synthase (EC 2.5.1.47)
test_aaFermentation Cysteine synthase (EC 2.5.1.47)


  Protein Sequence

>fig|575615.3.peg.1326 Cysteine synthase (EC 2.5.1.47)
MAHIAKQLTELIGGTPLLELGKFSVSNNLQTPIVAKIESFNPGGSVKDRIALAMIEDAER
SGVLKPGATIIEPTSGNTGVGLALVAAVKGYQLILTMPETMSVERRNLVKAYGAQVKLTP
GKDGMKGAIEMAQQLREEIPGAVILQQFENLANPERHYETTAREIWADTSGQVDVFVAGV
GTGGTVSGVGKYLKEKNPNVRIVAVEPADSPVLSGGKPGPHKIQGIGAGFVPKTYNGNVV
DEVVQVSNDDAIRTGRQLAQQEGVLAGISSGAAAFAAAQLAKRPENAGKRIVTLLPDTGE
RYLSTVLYAFEEYPL

MD5 = 5477d990a46cb7646758e18cbfb9e297


  DNA Sequence

>fig|575615.3.peg.1326 Cysteine synthase (EC 2.5.1.47)
atggcacatatcgcaaaacagctgaccgagctaatcggaggcaccccgttgttggaactt
ggtaagttttcggtttctaacaaccttcaaacgcccatcgtggcaaagatagagagtttt
aaccctggcggaagtgtgaaagatcgtattgcgctggctatgattgaggatgccgaacgc
agtggcgtgctgaaaccaggggcaaccattatcgaacctactagcggtaatacgggtgtg
ggcttggcacttgtggctgccgtaaagggctaccaactcatacttaccatgcccgaaacg
atgagcgttgagcgacgaaacttggtgaaggcatacggtgcgcaggtgaaacttacacca
ggaaaagatggcatgaagggggcaatagaaatggcgcaacaactaagggaggaaattcct
ggggcagttatactgcaacaatttgagaacctagctaaccccgaacggcattacgagact
acggcacgcgagatttgggccgatacgagcggacaagtagatgtgtttgttgctggtgtg
ggtacaggcggtacggtgtcgggcgttggaaaatacctgaaagagaaaaaccccaacgtg
cgtatcgtggctgttgaacctgctgattcgcccgtgctgagtggcggaaagccaggtccg
cacaagatacaaggcatcggtgcaggctttgttcccaaaacgtataatggcaatgtggta
gacgaagtggtgcaggtgagcaacgacgatgcgatacgtacgggcaggcaattggcccaa
caagagggtgtgttggctggtatttcgtcgggagcagccgcctttgccgcggcacaactg
gctaaacgccccgaaaacgcaggcaagcgcatcgttactttgttgcccgacacgggcgaa
cgctatctctcaacggtgctgtatgcctttgaggagtatcctttgtga


  DNA with Flanking Sequence

>fig|575615.3.peg.1326 Cysteine synthase (EC 2.5.1.47)
atgcttatcgactcgcatttagcagcattttgcactgcatttagcaccaaaacgcactgc
atttagcaccaaaacgcattgcatttagcaccaaaacgcactgtgtttagcaccaaaaca
cactgcatttagcaccaaaatgcactacatttagcagcaaatagcacaaagtatggtgca
aactgcggttttatgcaatgcgtattcattttgtcggcatccacaactgtcccctttttg
catccaaacaaaccttcacgagaattggatttttgcggtcgggtgggcggttggtggccg
aaaacgccactcataatgttaaaaaatgcgctgaaaattttacagatttgtgggaaatgg
gctgccttctcgcatagctgttcccctcgttcgagtgtgttggcacaaatataccacact
tatgcgattgcacgcctttgcgtttcttcgtaactttgcatcgtgaaaaagattattaat
cacaaaagaatatagagcgtatggcacatatcgcaaaacagctgaccgagctaatcggag
gcaccccgttgttggaacttggtaagttttcggtttctaacaaccttcaaacgcccatcg
tggcaaagatagagagttttaaccctggcggaagtgtgaaagatcgtattgcgctggcta
tgattgaggatgccgaacgcagtggcgtgctgaaaccaggggcaaccattatcgaaccta
ctagcggtaatacgggtgtgggcttggcacttgtggctgccgtaaagggctaccaactca
tacttaccatgcccgaaacgatgagcgttgagcgacgaaacttggtgaaggcatacggtg
cgcaggtgaaacttacaccaggaaaagatggcatgaagggggcaatagaaatggcgcaac
aactaagggaggaaattcctggggcagttatactgcaacaatttgagaacctagctaacc
ccgaacggcattacgagactacggcacgcgagatttgggccgatacgagcggacaagtag
atgtgtttgttgctggtgtgggtacaggcggtacggtgtcgggcgttggaaaatacctga
aagagaaaaaccccaacgtgcgtatcgtggctgttgaacctgctgattcgcccgtgctga
gtggcggaaagccaggtccgcacaagatacaaggcatcggtgcaggctttgttcccaaaa
cgtataatggcaatgtggtagacgaagtggtgcaggtgagcaacgacgatgcgatacgta
cgggcaggcaattggcccaacaagagggtgtgttggctggtatttcgtcgggagcagccg
cctttgccgcggcacaactggctaaacgccccgaaaacgcaggcaagcgcatcgttactt
tgttgcccgacacgggcgaacgctatctctcaacggtgctgtatgcctttgaggagtatc
ctttgtgaggagttaaggagttaagaagttaaggagttaagccaaatgtcttgaaggagt
taaggagttatggagttaaggagttatggagttaaggagttaagccaaatgccttgctgt
catgaacaaatacccttggttagcttgttcccttatcgtaaagctattggctcaacttct
taactagaaagggttaaaagatgatgcaatggccaacgccaacaaaactattggcttaac
tccttaactccttaactcctctttttacaggtcatccgcaaacacagggtcgtcgtacga
cagcatgattggtgcttgtgcagccatctttagtatgtcggccgacacatattgcttgtc
taccaccaaacggaagaagaagtcgttgaaccaattgttcgacatgatgaggtagccctt
gtgtccgttgtcgtctccccagctgttttcaacctcccatttcaatgccttaccttggct
gtctaggtcaacggccgttaaggtcatg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search