The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|573061.4.peg.499: Clostridium cellulovorans 743B

This feature in The SEED Viewer

NCBI Taxonomy Id: 573061

Current Assignment: Cysteine synthase (EC 2.5.1.47)
Translate Function Assignments



Context on contig NZ_BABR01000043 from base 252 to 7036 (6785 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
499 1187 252 936 -       3: 3 1 5   Cysteine synthase (EC 2.5.1.47) locus|Ccel74_010100002591, protein_id|ZP_07629460.1, gi|307687014, CDD:162219
500 1971 3104 1134 + 783     1: 1   Cystathionine beta-lyase (EC 4.4.1.8) locus|Ccel74_010100002596, protein_id|ZP_07629461.1, gi|307687015, CDD:144590
501 3252 4427 1176 + 147         Cystathionine beta-lyase (EC 4.4.1.8) locus|Ccel74_010100002601, protein_id|ZP_07629462.1, gi|307687016, CDD:31362
502 4478 5020 543 + 50         hypothetical protein locus|Ccel74_010100002606, protein_id|ZP_07629463.1, gi|307687017
503 5731 5204 528 - 183     3: 4 6 2   ADP-ribose pyrophosphatase (EC 3.6.1.13) locus|Ccel74_010100002611, protein_id|ZP_07629464.1, gi|307687018, CDD:72882
504 7036 5825 1212 - 93         Nitrite reductase probable [NAD(P)H] subunit (EC 1.7.1.4) locus|Ccel74_010100002616, protein_id|ZP_07629465.1, gi|307687019, CDD:31443

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Experimental_Sulfur_transfer_Archaea vcrecy Cysteine synthase (EC 2.5.1.47)
CLO_Cysteine Lerma-Ortiz_Claudia_user Cysteine synthase (EC 2.5.1.47)
Proline Cysteine synthase (EC 2.5.1.47)


  Protein Sequence

>fig|573061.4.peg.499 Cysteine synthase (EC 2.5.1.47)
MSKVYKSITELIGKTPLVELKNYGKVKGIDASIIAKIEFFNPAGSVKDRIAKAMIEDAET
KGLLKEGSVIIEPTSGNTGIGLASVAAARGYRIILTMPDTMSIERRNLLKAYGAELVLTE
GAKGMKGAIEKAKELGEEIPNSFLPGQFVNPSNPKIHRETTGPEIWEDIDGKVDIFVAGI
GTGGTITGVGEFLKSKNPDVKIVAVEPAASPVLSKGTPGPHKIQGIGAGFVPDVLNKGIY
DEIITVENEDAFETGRAIAKIEGILVGISSGAALWAATELANRPENHGKNIVVLLPDTGE
RYFSTPLFAEN

MD5 = 3021fa5b75f9c5d214389b1dddb2f780


  DNA Sequence

>fig|573061.4.peg.499 Cysteine synthase (EC 2.5.1.47)
atgtctaaagtttataaaagtattactgagttaattggaaagactccattagtagaatta
aaaaattacggtaaagtaaaaggtatagatgcttctataatcgctaagatagaatttttt
aatccagcaggaagtgttaaagatagaattgcaaaggctatgatagaggatgcggaaact
aaaggtcttttaaaagaaggctcagttataatagaacctactagtggtaatacaggaatt
ggccttgcatctgtagctgctgcaagaggatatagaattattttaactatgccagacaca
atgagtatagaaagaagaaatcttttaaaagcctatggtgctgaacttgtattaacagaa
ggtgcaaagggaatgaaaggtgcaatagaaaaagctaaggaacttggagaagagattcca
aattcattcctcccaggacaatttgtaaacccttctaaccctaaaattcatagagaaact
acaggaccggaaatatgggaggacatagatggaaaagttgatatttttgttgctggtatc
ggaacaggtggaactataacaggcgttggagaattcttaaaatcaaagaatcctgatgta
aagattgtggctgtagaaccagcagcttcaccagtactttcaaagggtacaccaggaccg
cataaaatacaaggcattggtgccgggtttgtaccagatgttcttaacaagggaatatat
gatgaaataataactgtagaaaatgaagatgcttttgaaacaggacgcgctattgcgaaa
atagaaggaatattggtcggaatttcatcaggagcagctctttgggcagcaactgagcta
gcaaacagacctgaaaatcatggaaagaacatcgtagttcttcttcctgatactggtgaa
agatatttctcaacacctcttttcgcagaaaactaa


  DNA with Flanking Sequence

>fig|573061.4.peg.499 Cysteine synthase (EC 2.5.1.47)
gcatattattaagttttaaagataaatgttatttcatagtaatgttataagttttatatg
tttaattataattgcaaacttaaagtatgtcaataaagaatttccataagttatattgtt
ttttaagacgttagtatatttttttcatgagacttaaataataaaacttatatgaggttt
ttgataaagaatctctatagggtatatacatttcttaatacgtccataatgctcggctaa
aatttaataatgcaacttatctatatgttaaaagattattagtttttagaaaaaaataat
aaaaatcagagtgtttagataataataattgcatagatatatggtattaaaagattattt
aaaaaaatacaaaacatagtaaacatatatgaaagatatttccttattgacatataatga
tattagatttataattaatccatactaaacctataagaattataaaatggatttataaaa
gtatgaaggagtgaatgtttatgtctaaagtttataaaagtattactgagttaattggaa
agactccattagtagaattaaaaaattacggtaaagtaaaaggtatagatgcttctataa
tcgctaagatagaattttttaatccagcaggaagtgttaaagatagaattgcaaaggcta
tgatagaggatgcggaaactaaaggtcttttaaaagaaggctcagttataatagaaccta
ctagtggtaatacaggaattggccttgcatctgtagctgctgcaagaggatatagaatta
ttttaactatgccagacacaatgagtatagaaagaagaaatcttttaaaagcctatggtg
ctgaacttgtattaacagaaggtgcaaagggaatgaaaggtgcaatagaaaaagctaagg
aacttggagaagagattccaaattcattcctcccaggacaatttgtaaacccttctaacc
ctaaaattcatagagaaactacaggaccggaaatatgggaggacatagatggaaaagttg
atatttttgttgctggtatcggaacaggtggaactataacaggcgttggagaattcttaa
aatcaaagaatcctgatgtaaagattgtggctgtagaaccagcagcttcaccagtacttt
caaagggtacaccaggaccgcataaaatacaaggcattggtgccgggtttgtaccagatg
ttcttaacaagggaatatatgatgaaataataactgtagaaaatgaagatgcttttgaaa
caggacgcgctattgcgaaaatagaaggaatattggtcggaatttcatcaggagcagctc
tttgggcagcaactgagctagcaaacagacctgaaaatcatggaaagaacatcgtagttc
ttcttcctgatactggtgaaagatatttctcaacacctcttttcgcagaaaactaaaact
aataacaggaagatagatgcagtggcaataaatgcatctatctttttatgtttataagaa
gataatgcgtaagaaataattgagaaatttttaagagatatcagttttattgataaagag
acctgagcagtaaagcgtccaataactatgtcaaatagttatgagtttccatgtaatcct
acataaataaattggagtggtacaggaaaatgagctatatacaagaaatggtggttcaaa
tcaatag


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search