The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|556269.4.peg.1769: Oxalobacter formigenes OXCC13

This feature in The SEED Viewer

NCBI Taxonomy Id: 556269

Current Assignment: Cysteine synthase (EC 2.5.1.47)
Translate Function Assignments



Context on contig NZ_GG658170 from base 649302 to 661243 (11942 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1766 650057 649302 756 -           hypothetical protein  
1767 651948 650260 1689 - 202         hypothetical protein  
1768 654591 652225 2367 - 276     4: 10 4 1 2   Cystathionine gamma-synthase (EC 2.5.1.48)  
1769 655562 654630 933 - 38   9: 8 1 5 2 18 16 14 17 6   Cysteine synthase (EC 2.5.1.47)  
1770 655691 655828 138 + 128         hypothetical protein  
1771 656291 655857 435 - 28 5 2: 11 3   Iron-sulfur cluster regulator IscR  
1772 656487 656600 114 + 195         hypothetical protein  
1773 659113 656723 2391 - 122         putative signal transduction histidine kinase  
1774 659354 661243 1890 + 240     5: 7 9 15 12 13   Lead, cadmium, zinc and mercury transporting ATPase (EC 3.6.3.3) (EC 3.6.3.5); Copper-translocating P-type ATPase (EC 3.6.3.4)  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Cysteine_Biosynthesis OlgaZ Cysteine synthase (EC 2.5.1.47)
Experimental_Sulfur_transfer_Archaea vcrecy Cysteine synthase (EC 2.5.1.47)
CLO_Cysteine Lerma-Ortiz_Claudia_user Cysteine synthase (EC 2.5.1.47)
Methionine_Biosynthesis rodionov Cysteine synthase (EC 2.5.1.47)
Cysteine_biosynthesis_HGM Cysteine synthase (EC 2.5.1.47)
Cysteine_biosynthesis_HGM_2 Ravcheev_Dmitry_user Cysteine synthase (EC 2.5.1.47)
Proline Cysteine synthase (EC 2.5.1.47)
Fermentation_of_amino_acids_HGM_2 Cysteine synthase (EC 2.5.1.47)
Cysteine_biosynthesis_PanGenomes Acharya_Geeta_user Cysteine synthase (EC 2.5.1.47)


  Protein Sequence

>fig|556269.4.peg.1769 Cysteine synthase (EC 2.5.1.47)
MSNIAKSATDLIGNTPLLEISRFGKHVDADATILAKLEYFNPAGSAKDRIAKAMIDAAEA
DGKLIPGSTIIEPTSGNTGIALAAVGAARGYRVIITMPETMSVERQKLIRGYGADLVLTE
GAKGMKGAIEKAQELAATIPGGFVPLQFANPANPAIHKATTGPEIWRDTDGKVDIFVAGV
GTGGTLTGVGKYLKEQNPAVQVVAIEPAASPVLAGGKPGPHKIQGIGAGFIPEALDVNVF
DEVIGVPNDAAFATAKTLAHAEGVLVGISSGAALWAASELAKRPENRGKTIVVLLADNGE
RYLSTDLFSN

MD5 = d85d05571b39dbe423cf4966ac774ad2


  DNA Sequence

>fig|556269.4.peg.1769 Cysteine synthase (EC 2.5.1.47)
atgtccaatattgcaaaaagcgcgaccgatctgatcggcaatacccctcttctggaaatc
tcccgcttcggcaaacacgtcgatgccgacgctacaattcttgccaaactggagtacttc
aatccggcagggagcgccaaagaccgtattgccaaagccatgatcgatgccgctgaagcc
gacggcaaactgatccccggttccaccatcatcgaaccgacctccggcaacaccggcatt
gcactggctgctgtcggtgccgcacgcggttaccgcgtcatcattaccatgcctgaaacc
atgagcgtcgaacgccagaaactgatccgcggctatggcgcagacctcgtgttgaccgaa
ggcgccaaaggcatgaaaggcgcgatcgaaaaagcgcaggaactggccgccaccattccg
ggcggcttcgtgccactgcaattcgccaatccggccaaccctgccatccacaaggcgacc
accggccctgaaatctggcgcgacacggacggcaaagtcgatattttcgtcgcaggcgtc
ggcactggtggcacgctgaccggcgttggaaaatatctgaaagaacagaacccggccgtt
caggtcgtcgccatcgaaccggctgcttcccctgttctggcaggcggcaaaccgggcccg
cacaagattcagggcatcggcgcgggtttcatccctgaagcgctggacgtcaacgtattc
gacgaagtcatcggagtcccgaatgatgccgcttttgcgaccgccaaaacgctggctcat
gctgaaggcgtactggtcggcatttcctccggcgcggcactctgggcagcatccgaactg
gcgaaacgccctgaaaacaggggcaaaaccatcgtcgtgctgctggccgacaatggtgaa
cgctacctgtcaaccgatctgttttcgaactga


  DNA with Flanking Sequence

>fig|556269.4.peg.1769 Cysteine synthase (EC 2.5.1.47)
ccgacatactccgtcctattgaagggacatttgcctgcgtcgcctgtctcgagcaaacgc
cgaatgcctgcccccgttatgaaagctgctcgaccgtccatttctgggaagggctgcatg
aagtcatgacgaattatctgaacggtaccacgctggccgatctggccgtcaaaaaacagg
gagagccgtgcccgagtacaccgtaaacaatgaaccccgttttttccggacgattcacgg
ataaaacgctttatacttccataaaaggagaacaagatgaatcagccataccagcaacga
cctgaccatactgccggaaaaaccgttccggtgcctgtatccgccagtctccttgccccc
ggtatgtgtcactgttctcccgtctttgccgacaatgcctgttgttgccccggtttttca
cgaatgtgcagcccgctgtaaattcgatcctgtttgagctttaccaaaataccgtttact
gattatttaaaggaatcatcatgtccaatattgcaaaaagcgcgaccgatctgatcggca
atacccctcttctggaaatctcccgcttcggcaaacacgtcgatgccgacgctacaattc
ttgccaaactggagtacttcaatccggcagggagcgccaaagaccgtattgccaaagcca
tgatcgatgccgctgaagccgacggcaaactgatccccggttccaccatcatcgaaccga
cctccggcaacaccggcattgcactggctgctgtcggtgccgcacgcggttaccgcgtca
tcattaccatgcctgaaaccatgagcgtcgaacgccagaaactgatccgcggctatggcg
cagacctcgtgttgaccgaaggcgccaaaggcatgaaaggcgcgatcgaaaaagcgcagg
aactggccgccaccattccgggcggcttcgtgccactgcaattcgccaatccggccaacc
ctgccatccacaaggcgaccaccggccctgaaatctggcgcgacacggacggcaaagtcg
atattttcgtcgcaggcgtcggcactggtggcacgctgaccggcgttggaaaatatctga
aagaacagaacccggccgttcaggtcgtcgccatcgaaccggctgcttcccctgttctgg
caggcggcaaaccgggcccgcacaagattcagggcatcggcgcgggtttcatccctgaag
cgctggacgtcaacgtattcgacgaagtcatcggagtcccgaatgatgccgcttttgcga
ccgccaaaacgctggctcatgctgaaggcgtactggtcggcatttcctccggcgcggcac
tctgggcagcatccgaactggcgaaacgccctgaaaacaggggcaaaaccatcgtcgtgc
tgctggccgacaatggtgaacgctacctgtcaaccgatctgttttcgaactgatccgggc
aaacagaacaataatgaaaaagagacgatcaatggaactggaaaccctctgtatccatgg
cggacgggccgacaccgacaaaagcggtgccatctcgacgcccatctaccagaccgcgac
ttttgcccatcccgcactgggcaaaagcaccggattcgactacacccgcgattccaaccc
cactcgtgacgcgctggaagcaaccatggcggaactggaaggcggtgcgcaggcgctcgc
cttcacctccggcatggcagccgccacgtgtctgatggaaatgttcaaacagggtgacca
tatcgtcgcctccgatgacctgtacggtggaacgtatcgtctcttcaaccagatatcact
taaaaacgggctgactttcgactgggccgataccaccgatccggctaaagtcgacgccct
gatcaggccggaaacgaaagcgatcttcatcgaaacgccgaccaatccgctgatgcacgt
gaccgatatccgg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004124       F:cysteine synthase activity
GO:0006535       P:cysteine biosynthetic process from serine
GO:0030170       F:pyridoxal phosphate binding
gb|EEO29499.1 Oxalobacter formigenes OXCC13     cysteine synthase A
gi|229379408 Oxalobacter formigenes OXCC13 NCBI   cysteine synthase A
gi|237748046 Oxalobacter formigenes OXCC13 NCBI   cysteine synthase A
ref|ZP_04578526.1 Oxalobacter formigenes OXCC13 RefSeq   cysteine synthase A
tr|C3X8H3 Oxalobacter formigenes OXCC13 TrEMBL   Cysteine synthase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
5 fig|556269.4.peg.1771 Iron-sulfur cluster regulator IscR


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search