The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|548474.3.peg.871: Staphylococcus aureus subsp. aureus TCH130

This feature in The SEED Viewer

NCBI Taxonomy Id: 548474

Current Assignment: Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
Translate Function Assignments



Context on contig NZ_GG698159 from base 195392 to 237400 (42009 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
868 195392 198832 3441 +           FIG01108718: hypothetical protein  
869 198852 199730 879 + 19     2: 9 5   DNA polymerase I 5'-3' exonuclease domain  
870 200206 201324 1119 + 475     3: 1 3 6   Alanine dehydrogenase (EC 1.4.1.1)  
871 201419 202459 1041 + 94     4: 2 7 4 8   Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)  
872 202490 203812 1323 + 30         Serine/threonine exchanger SteT  
873 203968 205359 1392 + 155         putative transporter  
874 205757 237400 31644 + 397         Putative Staphylococcal surface anchored protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Threonine_degradation OlgaV Threonine dehydratase, catabolic (EC 4.3.1.19)
Glycine_and_Serine_Utilization OlgaZ Threonine dehydratase, catabolic (EC 4.3.1.19)
Branched-Chain_Amino_Acid_Biosynthesis SvetaG Threonine dehydratase, catabolic (EC 4.3.1.19)
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user Threonine dehydratase, catabolic (EC 4.3.1.19)


  Protein Sequence

>fig|548474.3.peg.871 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
MTTNTVTLQTAHIVSLGDIEEAKASIKPFIRRTPLIKSMYLSQSITKGNVFLKLENMQFT
GSFKFRGASNKINHLTDEQKEKGIIAASAGNHAQGVALTAKLLGIDATIVMPETAPQAKQ
QATKGYGAKVILKGKNFNETRLYMEELAKENGMTIVHPYDDKFVMAGQGTIGLEILDDIW
NVNTVIVPVGGGGLIAGIATALKSFNPSIHIIGVQAENVHGMAESFYKRDLTEHREDSTI
ADGCDVKVPGEQTYEVVKHLVDEFILVTEEEIEHAMKDLMQRAKIITEGAGALPTAAILS
GKINNKWLEDKNVVALVSGGNVDLTRVSGVIEHGLNIADTSKGVVG

MD5 = 264ed0edee76436a66a8c295822120c6


  DNA Sequence

>fig|548474.3.peg.871 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
atgacaaccaacacagttacattacaaacagcacatattgtaagtttaggagatatcgaa
gaagctaaagcaagcattaaaccatttattcgtcgaacacctctaattaaatcaatgtat
ttaagccaaagtataactaaagggaatgtatttctaaaattagaaaatatgcaattcaca
ggatcttttaaatttagaggcgctagcaataaaattaatcacttaacagatgaacaaaaa
gaaaaaggcattatcgcagcatctgctgggaaccatgcacaaggtgttgctttaacagct
aaattattaggcattgatgcaacgattgtaatgcctgaaacagcaccacaagcgaaacaa
caagcaacaaaaggctatggggcaaaggttattttaaaaggtaaaaactttaacgaaact
agactttatatggaagaattagcgaaagaaaatggcatgacaatcgttcatccatatgac
gataagtttgtaatggcaggccaaggaacaattggtttagaaattttagatgatatttgg
aatgtgaatacagtcatcgtaccagttggcggtggaggattaattgcaggtattgccacc
gcattaaaatcatttaacccatcaattcatattatcggcgttcaagctgaaaatgtgcat
ggcatggcagagtcattctataagagagatttaactgaacatcgtgaagatagcacaatt
gcagatggttgtgatgtaaaagttcctggtgaacaaacatatgaagtagttaaacattta
gtagatgaatttattcttgttactgaagaagagattgaacatgctatgaaagatttaatg
cagcgtgccaaaattattactgaaggtgcaggcgcattaccaacagctgcaattttaagt
ggaaaaataaacaataaatggcttgaagataaaaatgttgttgctttagtttcaggcggg
aatgttgacttaactagagtttcaggtgtcattgaacatggactgaatattgcagataca
agcaagggtgtggtaggttaa


  DNA with Flanking Sequence

>fig|548474.3.peg.871 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
tacaattttaattccaggtgcgaaaccgccaaaattggttactcgtgagatggttaaatc
aatgaaaaaaggttcagtattaatcgatatagctattgaccaaggtggaactattgaaac
aattagaccaactacaatatctgatccagtgtatgaagaagaaggtgtgattcattacgg
tgtaccaaaccaaccaggagcagtcccaagaacttcaacaatggcattagcacaaggaaa
tattgattatatattagaaatttgtgacaaaggcttagaacaagcaattaaagataatga
atccttaagtactggtgtaaacatttaccaaggacaagtgacaaatcaaggattagcttc
atcacatgacctaaattataaagaaatattaaatgttatcgaatagatagtaatttaaat
gaaattgagtgaaatgaatattttaaatatagcattatagtttggactaaaaatttacaa
aacggaaggatgtaattattatgacaaccaacacagttacattacaaacagcacatattg
taagtttaggagatatcgaagaagctaaagcaagcattaaaccatttattcgtcgaacac
ctctaattaaatcaatgtatttaagccaaagtataactaaagggaatgtatttctaaaat
tagaaaatatgcaattcacaggatcttttaaatttagaggcgctagcaataaaattaatc
acttaacagatgaacaaaaagaaaaaggcattatcgcagcatctgctgggaaccatgcac
aaggtgttgctttaacagctaaattattaggcattgatgcaacgattgtaatgcctgaaa
cagcaccacaagcgaaacaacaagcaacaaaaggctatggggcaaaggttattttaaaag
gtaaaaactttaacgaaactagactttatatggaagaattagcgaaagaaaatggcatga
caatcgttcatccatatgacgataagtttgtaatggcaggccaaggaacaattggtttag
aaattttagatgatatttggaatgtgaatacagtcatcgtaccagttggcggtggaggat
taattgcaggtattgccaccgcattaaaatcatttaacccatcaattcatattatcggcg
ttcaagctgaaaatgtgcatggcatggcagagtcattctataagagagatttaactgaac
atcgtgaagatagcacaattgcagatggttgtgatgtaaaagttcctggtgaacaaacat
atgaagtagttaaacatttagtagatgaatttattcttgttactgaagaagagattgaac
atgctatgaaagatttaatgcagcgtgccaaaattattactgaaggtgcaggcgcattac
caacagctgcaattttaagtggaaaaataaacaataaatggcttgaagataaaaatgttg
ttgctttagtttcaggcgggaatgttgacttaactagagtttcaggtgtcattgaacatg
gactgaatattgcagatacaagcaagggtgtggtaggttaaaacatttaatcttaaaaat
gaggtgtaattatgtcaaatggtaaagaattacaaaaaaatataggtttcttctcagcgt
ttgctattgttatggggacagttattggttcaggagtattctttaaaatatcaaacgtaa
cagaagtaacaggaacagcaggaatggccttgtttgtatggttcctaggcggcatcatta
ccatttgtgcggggttaacagcagcagaacttgctgctgcaatccctgaaacaggtggct
taacgaagtatatagaatatacatacggtgatttctggggcttcctatcaggttgggcgc
aatcatttatttattttccagctaacgtagcagcattgtctatcgtatttgcgacacagc
taattaatttattccatttatctataggttcgttaataccaatagcaatcgcatctgcgt
tatctattgtgttgataaatttcctaggttcaaaagcaggcggaattttacaatcagtta
c


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
gb|EES97585.1 Staphylococcus aureus subsp. aureus TCH130     threonine dehydratase
gi|253728856 Staphylococcus aureus subsp. aureus TCH130 NCBI   threonine dehydratase
gi|253733316 Staphylococcus aureus subsp. aureus TCH130 NCBI   threonine dehydratase
ref|ZP_04867481.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   threonine dehydratase
tr|C5Q013 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Threonine dehydratase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search