The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|547043.8.peg.1884: Bifidobacterium pseudocatenulatum DSM 20438 = JCM 1200

This feature in The SEED Viewer

NCBI Taxonomy Id: 547043

Current Assignment: Threonine dehydratase, catabolic (EC 4.3.1.19)
Translate Function Assignments



Context on contig ABXX02000008 from base 10221 to 20036 (9816 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1880 10221 11513 1293 +           Multiple sugar ABC transporter, substrate-binding protein locus|BIFPSEUDO_04461, protein_id|EEG69908.1, gi|225156339, InterPro:IPR006059
1881 11528 12463 936 + 14         Predicted galactosides ABC transporter, membrane-spanning permease protein AgaF locus|BIFPSEUDO_04462, protein_id|EEG69909.1, gi|225156340, InterPro:IPR000515
1882 12502 13386 885 + 38         Predicted galactosides ABC transporter, membrane-spanning permease protein AgaG locus|BIFPSEUDO_04463, protein_id|EEG69910.1, gi|225156341, InterPro:IPR000515
1883 13788 15608 1821 + 401         Oligo-1,6-glucosidase (EC 3.2.1.10) locus|BIFPSEUDO_04464, protein_id|EEG69911.1, gi|225156342, InterPro:IPR006047, InterPro:IPR006589, InterPro:IPR013780, InterPro:IPR013781
1884 15824 17089 1266 + 215     3: 5 3 1   Threonine dehydratase, catabolic (EC 4.3.1.19) locus|BIFPSEUDO_04465, protein_id|EEG69912.1, gi|225156343, InterPro:IPR000634, InterPro:IPR001926, InterPro:IPR002912, InterPro:IPR005789
1885 18091 17336 756 - 246     2: 2 7   NAD-dependent protein deacetylase of SIR2 family locus|BIFPSEUDO_04466, protein_id|EEG69913.1, gi|225156344, InterPro:IPR001547, InterPro:IPR003000
1886 18214 18381 168 + 122         hypothetical protein locus|BIFPSEUDO_04467, protein_id|EEG69914.1, gi|225156345
1887 18422 19300 879 + 40         COG0657: Esterase/lipase locus|BIFPSEUDO_04468, protein_id|EEG69915.1, gi|225156346, InterPro:IPR013094
rna.71 19796 20036 241 + 495     3: 6 4 8   Small Subunit Ribosomal RNA; ssuRNA; SSU rRNA  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Leucine,_Isoleucine,_and_Valine_biosynthesis_HGM_2 Ravcheev_Dmitry_user Threonine dehydratase, catabolic (EC 4.3.1.19)
Propionate_production_HGM Threonine dehydratase, catabolic (EC 4.3.1.19)
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user Threonine dehydratase, catabolic (EC 4.3.1.19)


  Protein Sequence

>fig|547043.8.peg.1884 Threonine dehydratase, catabolic (EC 4.3.1.19)
MEQNEVLKALQRDHAAELKLAAERLKGTARHTEIIPSKVLSDMTGHEILLKPENLQVTGS
FKIRGAYNKIASLSDEQLARGIVTASAGNHAQGVAYAARERGAKATICMPQITPPLKVDA
TKAYGADVVLYGEVFDESAARAQELSDTEGMIYVPPFDDYEVLCGQGTIGLEILEDVPNV
TDVVVPLGGGGLGAGVALAIKTFKPEVRVIGAIPEGSPAWKNSLAAGHVVAADQVRTSAE
GVAVKRPGDLTFALLNEFLDDIVTVTERDINEMILLMLEKHKLVVEAAGAVSLAALEHLN
LRSRKFAEAKGPHVVVPIMSGGNEDTVSIGAVIQKGMITRGRIMHFEVELPDTPGQLVKV
ATLLAEQRANVIALDHDQFKASSHYANAVALGVTVETNGPDHIDRVLEALREAGFQPKRI
Y

MD5 = aff507215290f4bf94a1d644675920b9


  DNA Sequence

>fig|547043.8.peg.1884 Threonine dehydratase, catabolic (EC 4.3.1.19)
atggaacaaaacgaggttctcaaagcattgcagcgcgatcacgcagctgaactgaaacta
gccgccgaacgactcaagggcactgcgcgccacacggaaatcattccgtccaaggtgctg
tccgacatgaccggacatgagattctgctcaagcctgagaatctccaggtcaccggatcg
ttcaagattcgcggcgcctacaacaagatcgcatccctgagtgatgagcagctggctcgc
ggcattgtcaccgcttccgcgggcaaccatgcgcagggcgtggcctatgcggctcgcgaa
cgtggtgcgaaggcaacgatctgcatgccgcagatcactccgccgctgaaggttgacgcc
accaaggcgtacggtgcagacgtggtgctgtacggcgaggtgttcgacgaatccgcagcc
cgcgcccaggaattgagcgacaccgaaggcatgatctacgtgccgccattcgacgattac
gaggtgctgtgcggtcagggcaccatcggccttgaaatcctcgaagacgtgccgaacgtc
accgacgtggtcgtaccgctgggcggtggcggtcttggtgccggtgtggcgctcgccatc
aagacgttcaagccggaagtgcgcgtgatcggcgcgattccggagggtagcccagcatgg
aagaattcgctggccgcaggtcatgtggttgccgccgaccaggtgcgcacgtccgccgag
ggcgtcgccgtgaagcgtccgggcgatctcacgttcgcgctgctcaacgaattccttgac
gacatcgtcaccgtgaccgagcgtgacatcaacgagatgatcctgctcatgctcgaaaag
cacaagctggtggttgaggctgccggcgctgtgtctctggctgcgctcgagcacctcaac
ctgcgctcgcgcaagttcgctgaggcgaagggtccgcatgtggtggtgccgatcatgtct
ggcggtaatgaagacactgtgtccattggcgctgtgattcagaagggtatgatcacgcgt
ggccgcatcatgcatttcgaggtcgagctgcccgataccccgggacagctggtgaaggtc
gccacattgctggccgagcagcgtgcgaacgttatcgcgctggatcacgaccagttcaag
gcgtccagccattacgcgaatgccgtggctttgggcgtgacggttgaaacgaatggtccc
gaccacattgatcgtgtgctcgaggcattgcgggaagccggtttccagccgaagcgcatt
tactga


  DNA with Flanking Sequence

>fig|547043.8.peg.1884 Threonine dehydratase, catabolic (EC 4.3.1.19)
atgcgccacaacaacgcgaccatcgcgacgggcgaatggaatctggtcgcggcagacagc
gagcaggtgtattccttcacccgtaccagcggcgacgacacgattctcgtcatcgtcaat
ctcactgataggacggcgcaggtgcctgctgaggtcgcgcaactgcttgaggatggcgtg
ggcgagtcgcaggtactgctcagcacctatgatgctgtgcatagcgtaaagtcggtcgct
cgcggcgagctcgctcgctgggagggggtcgtgattcagctctgatcgatctttcctata
aactctctgcaaaaagcgttcgtgcgattcatcacgggatcgtacgaacgctttttcttt
atttgtattgtgatttatcagattatgtattgcgattattcctgattgcttgtgattact
tttcgcaagcaatctcacttttcatcgcgaaagccgcatgataaggcagtttcggcagac
gtacgcttacaataacgctcatggaacaaaacgaggttctcaaagcattgcagcgcgatc
acgcagctgaactgaaactagccgccgaacgactcaagggcactgcgcgccacacggaaa
tcattccgtccaaggtgctgtccgacatgaccggacatgagattctgctcaagcctgaga
atctccaggtcaccggatcgttcaagattcgcggcgcctacaacaagatcgcatccctga
gtgatgagcagctggctcgcggcattgtcaccgcttccgcgggcaaccatgcgcagggcg
tggcctatgcggctcgcgaacgtggtgcgaaggcaacgatctgcatgccgcagatcactc
cgccgctgaaggttgacgccaccaaggcgtacggtgcagacgtggtgctgtacggcgagg
tgttcgacgaatccgcagcccgcgcccaggaattgagcgacaccgaaggcatgatctacg
tgccgccattcgacgattacgaggtgctgtgcggtcagggcaccatcggccttgaaatcc
tcgaagacgtgccgaacgtcaccgacgtggtcgtaccgctgggcggtggcggtcttggtg
ccggtgtggcgctcgccatcaagacgttcaagccggaagtgcgcgtgatcggcgcgattc
cggagggtagcccagcatggaagaattcgctggccgcaggtcatgtggttgccgccgacc
aggtgcgcacgtccgccgagggcgtcgccgtgaagcgtccgggcgatctcacgttcgcgc
tgctcaacgaattccttgacgacatcgtcaccgtgaccgagcgtgacatcaacgagatga
tcctgctcatgctcgaaaagcacaagctggtggttgaggctgccggcgctgtgtctctgg
ctgcgctcgagcacctcaacctgcgctcgcgcaagttcgctgaggcgaagggtccgcatg
tggtggtgccgatcatgtctggcggtaatgaagacactgtgtccattggcgctgtgattc
agaagggtatgatcacgcgtggccgcatcatgcatttcgaggtcgagctgcccgataccc
cgggacagctggtgaaggtcgccacattgctggccgagcagcgtgcgaacgttatcgcgc
tggatcacgaccagttcaaggcgtccagccattacgcgaatgccgtggctttgggcgtga
cggttgaaacgaatggtcccgaccacattgatcgtgtgctcgaggcattgcgggaagccg
gtttccagccgaagcgcatttactgatttcagtaccgtttttcagtatttgataaccaat
aagggtcttggaaagccttgcgatgatttctgattgtcgcaaagcaatccaagacccttt
tgttgtttatattgcttgactagccgttacgtcattcggatttttgtcgttgaaaaattc
ggattttggtaacgaccaaccaaaaccggtgtaattccaacgatttgtgccggtactgca
agacgtacgagaaaacgtatttactgtgcggcttactgctcggcggtgatggtttcgtcg
acgagctgcggcagggcgacggcgatatcgtcgtggataagccggtcggccaaccgatcg
tattgcgtgcgtcccatgttcataatggtgatcggcacgcccgcctctgcggctatgggc
acgatgcttgccgcgggcatgacttccagcgtggatccgatgacccacagttcgtcggcc
tgcgttgcgagtcgatacgatttttcgagcgcgccgtccggcagcg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search