The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|546275.3.peg.1380: Fusobacterium periodonticum ATCC 33693

This feature in The SEED Viewer

NCBI Taxonomy Id: 546275

Current Assignment: Threonine dehydratase, catabolic (EC 4.3.1.19)
Translate Function Assignments



Context on contig NZ_GG665897 from base 97841 to 109763 (11923 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1376 99478 97841 1638 -       2: 4 9   Alkyl hydroperoxide reductase protein F (EC 1.6.4.-)  
1377 100248 99682 567 - 203     2: 4 14   Alkyl hydroperoxide reductase protein C (EC 1.6.4.-)  
1378 100757 100410 348 - 161         hypothetical protein  
1379 101262 102923 1662 + 504     3: 2 13 1   Dihydroxy-acid dehydratase (EC 4.2.1.9)  
1380 103183 104394 1212 + 259     10: 5 6 11 17 15 8 2 1 12 16   Threonine dehydratase, catabolic (EC 4.3.1.19)  
1381 104405 106126 1722 + 10     3: 10 2 1   Acetolactate synthase large subunit (EC 2.2.1.6)  
1382 106119 106607 489 + -8     2: 2 1   Acetolactate synthase small subunit (EC 2.2.1.6)  
1383 106853 108361 1509 + 245     3: 3 2 1   2-isopropylmalate synthase (EC 2.3.3.13)  
1384 108372 109763 1392 + 10     4: 18 3 7 1   Aconitate hydratase (EC 4.2.1.3)  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Threonine_degradation OlgaV Threonine dehydratase, catabolic (EC 4.3.1.19)
dcernst_RidA_Cysteine_phenotype Ernst_Dustin_user Threonine dehydratase, catabolic (EC 4.3.1.19)
TN_RidA_proteins Threonine dehydratase, catabolic (EC 4.3.1.19)
dcernst_RidA_proteins Ernst_Dustin_user Threonine dehydratase, catabolic (EC 4.3.1.19)
Branched-Chain_Amino_Acid_Biosynthesis SvetaG Threonine dehydratase, catabolic (EC 4.3.1.19)
RidA_proteins_copy_with_new_groups SvetaG Threonine dehydratase, catabolic (EC 4.3.1.19)
AdiR Ernst_Dustin_user Threonine dehydratase, catabolic (EC 4.3.1.19)
RidA_proteins ADHanson Threonine dehydratase, catabolic (EC 4.3.1.19)
All_RidA_Proteins Hodge_Kelsey_user Threonine dehydratase, catabolic (EC 4.3.1.19)
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user Threonine dehydratase, catabolic (EC 4.3.1.19)


  Protein Sequence

>fig|546275.3.peg.1380 Threonine dehydratase, catabolic (EC 4.3.1.19)
MHKLYDFMEARERLGTVIVKTKLIHSPVFSEESGNEVYLKPENLQKTGSFKIRGAYNKIA
KLSDEEKKKGVIASSAGNHAQGVAYAAKKLGIKAVIVMPQHTPLIKVEATRRYGAEVVLH
GEVYDDAYKKALELQKENGYVFVHPFNDEEVLEGQGTIALEILDELPNADIILVPLGGGG
LVSGIACAAKLKNPQIKVIGVEPEGAASALAALQKGEVVELKEANTIADGTAVKRIGEIN
FEYIKKYVDDIITVSDYELMETFLLLVEKHKIVAENSGILPVAAAKKLNVKGKKIVAVVS
GGNIDVLTISSMINKGLIMRGRIFTFSVQLADKPGELLKVSEILSKQNANVIKLEHNQFK
NLSRFKDVELQVTVETNGEEHIHKIIETFKKEGYEIERLNSQM

MD5 = 2f9808e0dd6ebbb18c0152d5c67e9d29


  DNA Sequence

>fig|546275.3.peg.1380 Threonine dehydratase, catabolic (EC 4.3.1.19)
atgcacaaactttatgattttatggaagcaagagaaagactgggaacagtaattgttaaa
acaaaattaattcatagtcctgtattctctgaggagtcaggaaatgaagtatatctaaaa
ccagaaaatttacaaaaaactggttcattcaaaataagaggagcatataacaaaattgca
aaactctctgatgaagaaaagaaaaaaggagttatagcttcatctgctggaaaccatgca
caaggtgttgcttatgcagcaaaaaaactaggaattaaggcagtaattgtaatgccacaa
cacacacctttaatcaaggtggaagcaactagaagatatggagcagaagttgttctccat
ggagaagtatatgatgatgcctataaaaaagccttagaattacaaaaagaaaatggctat
gtctttgtacatcctttcaatgatgaagaagtattagaagggcaaggaactattgcactt
gaaatattagatgaattacctaatgcagatattattcttgttcctcttggtggtggaggt
ttagtttctggaattgcctgtgctgcaaaattaaaaaatccacagataaaagttatagga
gttgagccagaaggagctgcatctgcacttgctgcattacaaaagggagaagttgttgaa
cttaaagaagcaaatacaatagcagatggtacagctgttaaaagaataggtgaaataaac
tttgaatatataaaaaaatatgttgatgacataatcactgtttctgattatgagcttatg
gaaactttcctattacttgttgaaaaacataaaatagttgcagaaaactcaggaatatta
cctgtggcagcagccaaaaaattaaatgttaaaggtaaaaaaatagttgctgttgtaagt
ggtggtaatatagatgttttaacaatttcatctatgataaataaaggacttattatgaga
ggtagaatctttactttctctgtacaattagctgataaacctggagaacttttaaaagtt
tctgaaattttatcaaaacaaaatgcaaatgttattaagctagaacataatcaatttaaa
aatttatcaagatttaaagatgttgagctacaagttacagttgaaactaatggtgaagaa
catattcataaaattattgaaacctttaagaaagaaggatatgaaatagagagattaaat
tctcaaatgtaa


  DNA with Flanking Sequence

>fig|546275.3.peg.1380 Threonine dehydratase, catabolic (EC 4.3.1.19)
agcatctattgggcatgtgtcacctgaagctgctgctggtggaacaatagcaatagtcca
agatggagatattattgaaatagatattccaaatagaaaaataaatgtaaagctttctga
tgaagaaatagcaagaagaaaagcagagttaaaaccttatgagcctaatgttaaaggata
tctaaaaagatatgcagcacatgtttcatcagctgcttcaggggctatctatatagaata
aaaattaaaatatataaatagggctattacaaattatctttgaatgtagataaaaaataa
gtgaaattgcattctaaattttagatgaaaaattaaagcaaatgagccgagcaaatctcg
ctgtgtttgaacaaagtgagtttagcgaatttgcagcgaatgttaatttttcatcgtcaa
gaaatttagctagcaatgaactattttttactacataaatatttgtaatagcacgtaaat
taaataggagaatttttaaaatgcacaaactttatgattttatggaagcaagagaaagac
tgggaacagtaattgttaaaacaaaattaattcatagtcctgtattctctgaggagtcag
gaaatgaagtatatctaaaaccagaaaatttacaaaaaactggttcattcaaaataagag
gagcatataacaaaattgcaaaactctctgatgaagaaaagaaaaaaggagttatagctt
catctgctggaaaccatgcacaaggtgttgcttatgcagcaaaaaaactaggaattaagg
cagtaattgtaatgccacaacacacacctttaatcaaggtggaagcaactagaagatatg
gagcagaagttgttctccatggagaagtatatgatgatgcctataaaaaagccttagaat
tacaaaaagaaaatggctatgtctttgtacatcctttcaatgatgaagaagtattagaag
ggcaaggaactattgcacttgaaatattagatgaattacctaatgcagatattattcttg
ttcctcttggtggtggaggtttagtttctggaattgcctgtgctgcaaaattaaaaaatc
cacagataaaagttataggagttgagccagaaggagctgcatctgcacttgctgcattac
aaaagggagaagttgttgaacttaaagaagcaaatacaatagcagatggtacagctgtta
aaagaataggtgaaataaactttgaatatataaaaaaatatgttgatgacataatcactg
tttctgattatgagcttatggaaactttcctattacttgttgaaaaacataaaatagttg
cagaaaactcaggaatattacctgtggcagcagccaaaaaattaaatgttaaaggtaaaa
aaatagttgctgttgtaagtggtggtaatatagatgttttaacaatttcatctatgataa
ataaaggacttattatgagaggtagaatctttactttctctgtacaattagctgataaac
ctggagaacttttaaaagtttctgaaattttatcaaaacaaaatgcaaatgttattaagc
tagaacataatcaatttaaaaatttatcaagatttaaagatgttgagctacaagttacag
ttgaaactaatggtgaagaacatattcataaaattattgaaacctttaagaaagaaggat
atgaaatagagagattaaattctcaaatgtaaaggagtttatatggcaaatgagaagatg
ataaaaggagctaggattttacttgaatgtttgtcaagattgggtataaatgaaattttt
ggctatcctggtggagctgttatacctatatatgatgaactatatagttttaaagagatt
aaacattattttgcaagacatgagcaaggtgctgttcatgaagctgatggttatgctagg
tcaactggtaaagttggtgcttgccttgcaacatctggaccaggagctacaaacttggta
acaggaattatgactgcacatatggactctattccattacttgtaataacagggcaagtt
agcagctctttattgggtaaggatgccttccaagaatcagatatagttggtattacagtg
cctataacaaaaaataattatttggttcaagatataaaagacttgcctagaatacttaaa
gaagcctattatattgcaagtacaggaagacctggacctgttttggtggata


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search