The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|519442.4.peg.2208: Halorhabdus utahensis DSM 12940

This feature in The SEED Viewer

NCBI Taxonomy Id: 519442

Current Assignment: Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
Translate Function Assignments



Context on contig 4083004.C6 from base 2228641 to 2240422 (11782 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2201 2228641 2229489 849 +       2: 2 8 ff
ilit(
11006846)
ilit(11185885)
ilit(12511575)
ilit(13682989)
ilit(14741209)
ilit(3062174)
ilit(377278)
ilit(4358959)
ilit(5337591)
ilit(7732725)
ilit(9767718)
isu
ATP phosphoribosyltransferase (EC 2.4.2.17) => HisGl  
2202 2229554 2229832 279 + 64     1: 1   hypothetical protein  
2203 2231076 2229859 1218 - 26     1: 4 ff
ilit(
12629550)
ilit(12721618)
ilit(1705709)
ilit(2361015)
ilit(2451788)
isu
Potassium channel protein  
2204 2231209 2231063 147 - -14     1: 1   hypothetical protein  
2205 2231288 2232427 1140 + 78     1: 6 ff
idu(2)
ilit(
11502169)
ilit(15923350)
ilit(16648587)
ilit(1756983)
ilit(1986232)
ilit(2269303)
ilit(2491664)
ilit(3442626)
ilit(3540614)
ilit(6090126)
ilit(7545181)
ilit(7698664)
ilit(7704526)
ilit(7904043)
ilit(8045898)
ilit(8532683)
ilit(8863415)
ilit(9006016)
ilit(9103608)
ilit(9254593)
Citrate synthase (si) (EC 2.3.3.1)  
2206 2232503 2232934 432 + 75         Universal stress protein family  
2207 2233888 2233025 864 - 90         Oxidoreductase, aldo/keto reductase family  
2208 2233990 2235201 1212 + 101     8: 9 5 12 14 11 15 13 10 ff
ilit(
1400210)
ilit(782558)
isu
isu
Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)  
2209 2235928 2235230 699 - 28     1: 1   hypothetical protein  
2210 2236361 2236014 348 - 85     1: 1   hypothetical protein  
2211 2236491 2237615 1125 + 129     1: 7   tRNA (guanine(26)-N(2))-dimethyltransferase (EC 2.1.1.216)  
2212 2237945 2237655 291 - 39     1: 1   hypothetical protein  
2213 2238301 2237957 345 - 11     1: 3 idu(8) Transcriptional regulator, ArsR family  
2214 2239843 2238374 1470 - 72         Domain of unknown function / Sulfite oxidase-like protein, molybdopterin-binding  
2215 2240153 2239836 318 - -8     1: 1   hypothetical protein  
2216 2240186 2240422 237 + 32     1: 1   hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Threonine_degradation OlgaV Threonine dehydratase (EC 4.3.1.19)
YggSProC belyacoubi Threonine dehydratase (EC 4.3.1.19)
Branched-Chain_Amino_Acid_Biosynthesis SvetaG Threonine dehydratase (EC 4.3.1.19)
RidA_family_in_981_representative_prokaryotes Niehaus_Tom_user Threonine dehydratase, catabolic (EC 4.3.1.19)
RidA_family_in_981_representative_prokaryotes Niehaus_Tom_user L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
TN_RidA:_all_subgroups,_981_genomes_PLP Niehaus_Tom_user Threonine dehydratase, catabolic (EC 4.3.1.19)
TN_RidA:_all_subgroups,_981_genomes_PLP Niehaus_Tom_user L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
AdiR Ernst_Dustin_user Threonine dehydratase, catabolic (EC 4.3.1.19)
GB_RidA_family_in_981_representative_prokaryotes Beaudoin_Guillaume_user Threonine dehydratase, catabolic (EC 4.3.1.19)
GB_RidA_family_in_981_representative_prokaryotes Beaudoin_Guillaume_user L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
COG2945 Niehaus_Tom_user Threonine dehydratase, catabolic (EC 4.3.1.19)
COG2945 Niehaus_Tom_user L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)


  Protein Sequence

>fig|519442.4.peg.2208 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
MLTREDVLVARDRVSETARHTPLERSYSLSAMTGADVHLKYETVQRTGSFKIRGATNRIA
TLTDEQQAAGVVAASAGNHAQGVALAATRMGVDSTIVMPERAPVAKVKATRSYGGDVVLH
GRDYDAAAERAHEIAEAEGRTYVPAFDDERVMAGQGTLGLEIATDCPDVDTVVVSVGGGG
LIAGVATALKAWNDDVRVIGVQAEGAASLPQSLEAGEIVEREAVETIADGIATRKVGELP
FEVIQNRVDEVVTVPDSAIAVAVTTLLERTKTLVEGGGAVPVAALLEGAFEYEADETIVP
VLSGGNIDLNVLTTVIMRGLIETGRYLRIRTVLEDRPGALEELVEVISRERGNIYAIEHD
RASRDIAMDDTVVDLDIETRGPDHVESLLDALEDSGYEVEVLV

MD5 = f9674facb3d3db420c7f4187c6298a81


  DNA Sequence

>fig|519442.4.peg.2208 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
atgctcactcgcgaggacgtgctcgtagctcgcgatcgtgtgtccgaaacggcccgacac
acgcccctggagcgatcgtactccctctcggcgatgaccggcgcggacgtccacctcaag
tacgagaccgtccagcggacggggtcgttcaagatccgtggcgcgaccaaccggatcgcg
acgctcaccgacgaacagcaggccgccggcgtcgtcgcggcgagtgccggcaaccacgcc
cagggggtcgcgctcgctgcaacccggatgggcgtcgattcgaccatcgtcatgcccgag
cgggccccagttgcgaaggtcaaggccacccggagctacgggggcgacgtggtcctccac
ggcagggattacgacgcggcggccgaacgtgcccacgagatcgccgaggcggaggggcgc
acctacgtccccgccttcgacgacgaacgggtgatggccggccagggaaccctcggcctg
gagatcgcgacggactgccccgacgtggacacggtcgtcgtctcggtgggtggcggcggc
ctcatcgctggcgtcgccacggcgctcaaggcctggaacgacgacgtacgggtgatcggc
gtccaggcggaaggcgcggcgagcctcccacagtcgctggaagcgggcgaaatcgtcgag
cgcgaagctgtcgaaacgatcgccgacggcatcgccacgcggaaagtcggcgagttgccc
ttcgaagtgatccaaaatcgggtcgacgaagtcgtcaccgtccctgactcagcgatcgcc
gtggcagtgacaacactcctcgaacggaccaagacgctcgtcgagggcggcggtgcggtg
ccggtcgctgccctcttggagggagccttcgaatacgaagcggatgagacgatcgtcccg
gtgctttcgggtggaaacatcgacctcaacgtcctgacgacggtcatcatgcgcgggctg
atcgagaccggccggtatctccggatcaggacagtcctggaagatcgccccggggcgctg
gaggaactcgtcgaggtgatctcacgggagcgtgggaacatctacgcgatcgagcacgac
cgcgcctcgcgggacatcgcgatggacgacaccgtcgtggacctggatatcgagacccgg
gggcccgaccacgtcgaatcgttgctcgatgcgctcgaagacagtggctacgaggtcgag
gtgctcgtctga


  DNA with Flanking Sequence

>fig|519442.4.peg.2208 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
ccggtggaactgatagagatcgatctgatcggtccggagtcgatcgcgactggcgagtac
ctggttgtggaggtactcggggtcgccgtggggcgtccactcgccgtcgcgatgccggag
caggccggccttcgaggcaaccacgacgtcgtcctcggcggtcagggcctcaccgagcag
gcgctcgctgacgcccgggccgtaggagtcggcggtgtcgatgaagtcgacgccaagttc
gacggcccggcggatcacgtccttcgcggcgtcctcgtccgccggcggaccgatgatgtc
ctcgccggtcaatcgcatcgcgccgaatccaagtcggtggaccgtcagctccccgccgat
gtcgaacgtgtcgctgtcgttgtgtgggttttcagccatcgcttcgcacgtcgaaggcca
gcctcaaagcgttggcggggccggcgatcgacagtccccgcgcccgccacagttaccact
gtccggacgcaatctcgggcatgctcactcgcgaggacgtgctcgtagctcgcgatcgtg
tgtccgaaacggcccgacacacgcccctggagcgatcgtactccctctcggcgatgaccg
gcgcggacgtccacctcaagtacgagaccgtccagcggacggggtcgttcaagatccgtg
gcgcgaccaaccggatcgcgacgctcaccgacgaacagcaggccgccggcgtcgtcgcgg
cgagtgccggcaaccacgcccagggggtcgcgctcgctgcaacccggatgggcgtcgatt
cgaccatcgtcatgcccgagcgggccccagttgcgaaggtcaaggccacccggagctacg
ggggcgacgtggtcctccacggcagggattacgacgcggcggccgaacgtgcccacgaga
tcgccgaggcggaggggcgcacctacgtccccgccttcgacgacgaacgggtgatggccg
gccagggaaccctcggcctggagatcgcgacggactgccccgacgtggacacggtcgtcg
tctcggtgggtggcggcggcctcatcgctggcgtcgccacggcgctcaaggcctggaacg
acgacgtacgggtgatcggcgtccaggcggaaggcgcggcgagcctcccacagtcgctgg
aagcgggcgaaatcgtcgagcgcgaagctgtcgaaacgatcgccgacggcatcgccacgc
ggaaagtcggcgagttgcccttcgaagtgatccaaaatcgggtcgacgaagtcgtcaccg
tccctgactcagcgatcgccgtggcagtgacaacactcctcgaacggaccaagacgctcg
tcgagggcggcggtgcggtgccggtcgctgccctcttggagggagccttcgaatacgaag
cggatgagacgatcgtcccggtgctttcgggtggaaacatcgacctcaacgtcctgacga
cggtcatcatgcgcgggctgatcgagaccggccggtatctccggatcaggacagtcctgg
aagatcgccccggggcgctggaggaactcgtcgaggtgatctcacgggagcgtgggaaca
tctacgcgatcgagcacgaccgcgcctcgcgggacatcgcgatggacgacaccgtcgtgg
acctggatatcgagacccgggggcccgaccacgtcgaatcgttgctcgatgcgctcgaag
acagtggctacgaggtcgaggtgctcgtctgatcgtggcgaccaccgcgacgtgcccgaa
tcactcgaggcggacgtcgtcgaggacgccgacagccgtcgtctcccagacgatattgag
gccgaccgcgatcaatccctcgccgtcgtgctcgacgggatactcgtaggtcttccagcc
ctcgtgatcggccaactggttggaccggtcaaagtccgcctcggcgagtccgtcttcggg
gatcggccccgcataggtggcgacctggagaatctcgttgaacgactcctgatcgctgta
gccggcgaccgagagggcctcgacgtcggtgaggtcgacttcctgttggacccaaaccgt
gccgtcgtcggcactgccgtcgatctcgatggcgagggccgtctcgccgtcggccgataa
ctccgtcgtcgtccgaacgtccgagtcgactggctccccggagttgttcgggtcctccgg
caggtctttcccgaccgtccacccctccaggccggactcgaagctggcgttc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004794       F:L-threonine ammonia-lyase activity
GO:0006520       P:amino acid metabolic process
GO:0016597       F:amino acid binding
GO:0030170       F:pyridoxal phosphate binding
gb|ACV11701.1 Halorhabdus utahensis DSM 12940     threonine dehydratase
gi|256691364 Halorhabdus utahensis DSM 12940 NCBI   threonine dehydratase
gi|257052601 Halorhabdus utahensis DSM 12940 NCBI   threonine dehydratase
kegg|hut:Huta_1526 Halorhabdus utahensis DSM 12940 KEGG   threonine dehydratase
ref|YP_003130434.1 Halorhabdus utahensis DSM 12940 RefSeq   threonine dehydratase
tr|C1VU29 Halorhabdus utahensis DSM 12940 TrEMBL   L-threonine ammonia-lyase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code ff
evidence_code ilit(1400210);fig|272623.1.peg.1262
evidence_code ilit(782558);fig|4932.3.peg.2080
evidence_code isu;Branched-Chain_Amino_Acid_Biosynthesis
evidence_code isu;Threonine_degradation


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search