The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|483218.5.peg.1781: Bacteroides pectinophilus ATCC 43243

This feature in The SEED Viewer

NCBI Taxonomy Id: 483218

Current Assignment: Cysteine synthase (EC 2.5.1.47)
Translate Function Assignments



Context on contig NZ_DS996921 from base 1770517 to 1781908 (11392 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1773 1770517 1771050 534 +           Acetyltransferase, GNAT family  
1774 1771087 1772217 1131 + 36     1: 13   Rhodanese-like domain / tRNA-cytidine(32) 2-sulfurtransferase TtcA  
1775 1772672 1772310 363 - 92         Amidohydrolase  
1776 1772763 1773314 552 + 90         putative histidinol-phosphate aminotransferase  
1777 1773311 1773463 153 + -4     1: 1   hypothetical protein  
1778 1773742 1774332 591 + 278         hypothetical protein  
1779 1774362 1774793 432 + 29     1: 25   Flavodoxin  
1780 1774797 1775588 792 + 3         Metal transporter, ZIP family  
1781 1775787 1776719 933 + 198     13: 6 8 4 12 3 9 21 28 24 18 19 27 10   Cysteine synthase (EC 2.5.1.47)  
1782 1776745 1777179 435 + 25     3: 16 2 5   Iron-sulfur cluster regulator IscR  
1783 1777214 1778509 1296 + 34     3: 4 7 3   O-acetyl-L-homoserine acetate-lyase (adding methanethiol) (EC 2.5.1.49)  
1784 1778730 1779440 711 + 220     3: 23 2 17   GTP pyrophosphokinase (EC 2.7.6.5)  
1785 1779437 1779997 561 + -4     2: 1 22   Putative membrane-associated phospholipid phosphatase, PAP2 superfamily  
1786 1780013 1780486 474 + 15     1: 1   hypothetical protein  
1787 1780593 1780937 345 + 106     1: 1   hypothetical protein  
rna.37 1781047 1781122 76 + 109         tRNA-Val-TAC  
rna.38 1781154 1781230 77 + 31         tRNA-Met-CAT  
1788 1781357 1781908 552 + 126     5: 26 15 11 14 20   2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (EC 4.6.1.12)  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Cysteine_Biosynthesis OlgaZ Cysteine synthase (EC 2.5.1.47)
Experimental_Sulfur_transfer_Archaea vcrecy Cysteine synthase (EC 2.5.1.47)
Cysteine_Biosynthesis,_MCB_432 gjo Cysteine synthase (EC 2.5.1.47)
CLO_Cysteine Lerma-Ortiz_Claudia_user Cysteine synthase (EC 2.5.1.47)
dcernst_RidA_Cysteine_phenotype Ernst_Dustin_user Cysteine synthase (EC 2.5.1.47)
dcernst_RidA_proteins Ernst_Dustin_user Cysteine synthase (EC 2.5.1.47)
TN_RidA:_all_subgroups,_981_genomes_PLP Niehaus_Tom_user Cysteine synthase (EC 2.5.1.47)
Methionine_Biosynthesis rodionov Cysteine synthase (EC 2.5.1.47)
Cysteine_biosynthesis_HGM Cysteine synthase (EC 2.5.1.47)
Cysteine_biosynthesis_HGM_2 Ravcheev_Dmitry_user Cysteine synthase (EC 2.5.1.47)
Proline Cysteine synthase (EC 2.5.1.47)
Fermentation_of_amino_acids_HGM_2 Cysteine synthase (EC 2.5.1.47)
Cysteine_biosynthesis_PanGenomes Acharya_Geeta_user Cysteine synthase (EC 2.5.1.47)


  Protein Sequence

>fig|483218.5.peg.1781 Cysteine synthase (EC 2.5.1.47)
MGKIYENVAELIGKTPLLHANNFEKKRGVEANIFAKLEYFNPAGSVKDRVALAMINDAEQ
RGILKEGSVIIEPTSGNTGIGLASIAAARGYRIILTMPETMSIERRNLLKAYGAELVLTE
GSKGMKGAIAKAEELAKETPDSFIPGQFVNPANPAAHKATTGPEIWEDTEGNVDIFIAGV
GTGGTVTGIGEFLKSKNPDIKVIAVEPAGSPVLSTGKGGPHMIQGIGAGFVPDVLNTKIY
DEIVTIENEDAFDAGREFAKAEGILVGISSGAALHAAEIVAARPENKGRNIVVLLPDTGD
RYLSTALFNR

MD5 = 3c046182391b47b756dabe74857e45fa


  DNA Sequence

>fig|483218.5.peg.1781 Cysteine synthase (EC 2.5.1.47)
atgggaaagatttatgagaacgtagcggaacttataggtaagacaccacttttacatgct
aataattttgagaagaagagaggtgttgaagctaacatattcgccaagcttgaatacttt
aatcctgcaggaagcgttaaggacagagtagcacttgcaatgattaatgatgcagagcag
agaggaatccttaaggaaggttcggttataatcgagcctacaagcggtaacacaggaatc
gggcttgcttcaatcgcagcagcaagaggatacagaataattcttacaatgcctgagaca
atgagcattgagagaagaaacctccttaaggcttatggtgcagagcttgttcttacagaa
ggttctaagggtatgaagggtgcaattgctaaggctgaagaactggctaaggagacacct
gattcatttataccgggacagtttgttaatcctgccaatccagcagcacataaggctaca
acaggacctgagatatgggaagatacagaaggcaatgtagacatatttatcgcaggtgta
ggtacaggtggtacagttacaggtatcggagaattccttaagtctaagaatcctgatatt
aaggttatagcagtagaacctgcgggttcaccggtgctttcaacaggcaagggcggccct
catatgattcagggaattggtgccggatttgttcctgatgtacttaataccaagatttat
gatgaaatagtaacaattgagaatgaggatgcatttgatgcaggtcgtgaatttgccaag
gctgaaggaatacttgtaggtatatcttcgggagcagcacttcatgcggcagagatagtt
gcggcgagacctgagaataaaggcaggaatatagtagtacttcttcctgatacaggtgac
agatacctttcaactgcattgttcaaccgttaa


  DNA with Flanking Sequence

>fig|483218.5.peg.1781 Cysteine synthase (EC 2.5.1.47)
ctgaaggtgcgataatctccctgccattaaaatcagaaggagtaggaacatggaaagcat
ttctgtatggggcactgtcaggagtggttgagcctataggagctgttcttacaataattg
cggcagggctggtcattccggccctgccgtatcttcttggattcgctgccggggcaatgt
tatatgtcgtggtagaagagctgatacctgagatgtcggcaggcaggcacagcaatgcgg
cgacccttatgttcggacttggttttactgtaatgatgatgcttgacgtagcgctgggat
gagcggaaaaacattaaaaacttaatgaaatatttttcgtgaaatattttttgaaataag
tattgacaaatgctttgtacatggtataatcctaaacatagatttcatattaattcagta
tgaattatatgagaatagggaaaaggaatttctatatggttcattgaatattcaggggat
tgaaaggagacaattataccatgggaaagatttatgagaacgtagcggaacttataggta
agacaccacttttacatgctaataattttgagaagaagagaggtgttgaagctaacatat
tcgccaagcttgaatactttaatcctgcaggaagcgttaaggacagagtagcacttgcaa
tgattaatgatgcagagcagagaggaatccttaaggaaggttcggttataatcgagccta
caagcggtaacacaggaatcgggcttgcttcaatcgcagcagcaagaggatacagaataa
ttcttacaatgcctgagacaatgagcattgagagaagaaacctccttaaggcttatggtg
cagagcttgttcttacagaaggttctaagggtatgaagggtgcaattgctaaggctgaag
aactggctaaggagacacctgattcatttataccgggacagtttgttaatcctgccaatc
cagcagcacataaggctacaacaggacctgagatatgggaagatacagaaggcaatgtag
acatatttatcgcaggtgtaggtacaggtggtacagttacaggtatcggagaattcctta
agtctaagaatcctgatattaaggttatagcagtagaacctgcgggttcaccggtgcttt
caacaggcaagggcggccctcatatgattcagggaattggtgccggatttgttcctgatg
tacttaataccaagatttatgatgaaatagtaacaattgagaatgaggatgcatttgatg
caggtcgtgaatttgccaaggctgaaggaatacttgtaggtatatcttcgggagcagcac
ttcatgcggcagagatagttgcggcgagacctgagaataaaggcaggaatatagtagtac
ttcttcctgatacaggtgacagatacctttcaactgcattgttcaaccgttaaacagatg
cagtgaagaggtgaaagaatgaagatttcaacaagaggaagatatgcgctcagaatgatg
cttgaccttgccgtcaataataatggagagccgataaggcttaaggatatttcgaagaga
cagggaatatcagacaaatatcttgagcagataatatcgatacttaataaggcgggcttt
gtgcgaagcatcagaggtccgcagggcggatacatgcttaaccgtgagccgaaggaatac
actgtgggaatgattctgcggctcacggagggcagtcttgcccctgtagcgtgtcttgac
tatgaaccgaatgactgtgagaggcggaatgaatgcgtaacactgattctttgggaaaag
cttaatgacgcgataaagagtgttgtagataatatcacacttcaggatctggtgcagtgg
cagatggagaagtctgataactatataatataatctgattaaaacatttatggaggagaa
aaagactatggca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004124       F:cysteine synthase activity
GO:0006535       P:cysteine biosynthetic process from serine
GO:0016740       F:transferase activity
GO:0030170       F:pyridoxal phosphate binding
gb|EEC57614.1 Bacteroides pectinophilus ATCC 43243     hypothetical protein BACPEC_02123
gi|217991608 Bacteroides pectinophilus ATCC 43243 NCBI   hypothetical protein BACPEC_02123
gi|218134233 Bacteroides pectinophilus ATCC 43243 NCBI   hypothetical protein BACPEC_02123
ref|ZP_03463037.1 Bacteroides pectinophilus ATCC 43243 RefSeq   hypothetical protein BACPEC_02123
tr|B7ASR8 Bacteroides pectinophilus ATCC 43243 TrEMBL   Cysteine synthase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search