The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|483215.6.peg.430: Bacteroides finegoldii DSM 17565

This feature in The SEED Viewer

NCBI Taxonomy Id: 483215

Current Assignment: Cysteine synthase (EC 2.5.1.47)
Translate Function Assignments



Context on contig NZ_GG688317 from base 508382 to 520411 (12030 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
425 510430 508382 2049 -           Dipeptidyl-peptidase III (EC 3.4.14.4)  
426 510990 510526 465 - 95         Transcriptional regulator, AraC/XylS family  
427 511260 513065 1806 + 269     5: 17 20 11 18 8   ATP-dependent DNA helicase RecQ  
428 513147 513058 90 - -8         hypothetical protein  
429 513995 513177 819 - 29         TPR-repeat-containing protein  
430 514946 514029 918 - 33     12: 10 4 14 15 12 7 21 9 6 16 19 13   Cysteine synthase (EC 2.5.1.47)  
431 515191 516948 1758 + 244         putative sulfatase  
432 516999 517688 690 + 50         putative membrane-associated phospholipid phosphatase  
433 518833 517772 1062 - 83     4: 5 2 1 3   3-isopropylmalate dehydrogenase (EC 1.1.1.85)  
434 520411 518894 1518 - 60     3: 2 1 3   (R)-citramalate synthase (EC 2.3.1.182)  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Cysteine_Biosynthesis OlgaZ Cysteine synthase (EC 2.5.1.47)
Experimental_Sulfur_transfer_Archaea vcrecy Cysteine synthase (EC 2.5.1.47)
Cysteine_Biosynthesis,_MCB_432 gjo Cysteine synthase (EC 2.5.1.47)
CLO_Cysteine Lerma-Ortiz_Claudia_user Cysteine synthase (EC 2.5.1.47)
dcernst_RidA_Cysteine_phenotype Ernst_Dustin_user Cysteine synthase (EC 2.5.1.47)
dcernst_RidA_proteins Ernst_Dustin_user Cysteine synthase (EC 2.5.1.47)
Methionine_Biosynthesis rodionov Cysteine synthase (EC 2.5.1.47)
Cysteine_biosynthesis_HGM Cysteine synthase (EC 2.5.1.47)
Cysteine_biosynthesis_HGM_2 Ravcheev_Dmitry_user Cysteine synthase (EC 2.5.1.47)
Proline Cysteine synthase (EC 2.5.1.47)
Fermentation_of_amino_acids_HGM_2 Cysteine synthase (EC 2.5.1.47)
Cysteine_biosynthesis_PanGenomes Acharya_Geeta_user Cysteine synthase (EC 2.5.1.47)


  Protein Sequence

>fig|483215.6.peg.430 Cysteine synthase (EC 2.5.1.47)
MGNTPLMELSGYCGKYGLEQNIIAKLEAFNPAGSVKDRVALSMIEDAEARGVLKPGATII
EPTSGNTGVGLAMVATIKGYHLILTMPETMSLERRNLLKALGAEIVLTDGLGGMAASIAK
AEELRDSIPGSVILQQFENPANAAAHERTTGEEIWRDTDGEVDVFVAGVGTGGTVCGVAR
ALKKHNPDIYIVAVEPAASPVLEGGQAAPHRIQGIGANFIPKLYDASMIDEVIGVPDDEA
IRAGRELSATEGLLTGISSGAAVYAARQLAQRPEFKNKKIVALLPDTGERYLSTELFAFD
AYPLD

MD5 = 0ad709a469ff26a35b3477a9dc18ddcc


  DNA Sequence

>fig|483215.6.peg.430 Cysteine synthase (EC 2.5.1.47)
gtggggaatactcctctgatggagctttccggttattgtggtaagtatggtctggaacaa
aatattattgccaaactggaggcctttaatccggcgggaagtgtgaaagacagggtggct
ctttcgatgattgaagatgcggaggcacgtggggtattgaagcccggcgcaacgataatc
gaaccgacaagcggaaatacaggtgtcggactggcaatggtcgctaccatcaaaggatat
cacctgatattgacaatgcctgagacgatgagtctggaacggcgtaacctgttgaaagca
ctcggtgcggaaatcgttctgacagacggcttgggcggaatggcggcttccattgcaaag
gctgaggaattgcgagacagtattcccggttcggtgattctgcaacaatttgagaatcca
gccaatgcggcggcgcatgagcgtacgacaggagaagaaatctggcgggatacagatggt
gaagtagacgtttttgttgccggagtcggcaccggaggaacggtttgcggtgtagcccgt
gctttaaagaaacataatcccgatatttatatcgtagcggtagaaccggctgcgtctcct
gtattggaaggtggacaggcggctccacaccgtattcagggaatcggagccaattttatt
cctaaactttatgatgcttctatgatagacgaagttatcggtgtgcctgatgatgaagcg
attcgtgcaggacgtgagctatcggcaacggaaggcttgttgaccggaatttcttcggga
gcagctgtgtatgcagcccgtcaactagcacagcgtccggaatttaaaaacaaaaagata
gtggcgttgttacctgatacgggagagcgttatttgtcaacggaattgtttgcatttgac
gcatatccgttggactga


  DNA with Flanking Sequence

>fig|483215.6.peg.430 Cysteine synthase (EC 2.5.1.47)
gacggaatccccagaaaccgtatagcccgagatcgacaataaagatacatgccataacaa
atgctatcaatccgaaatagacttgccggatgcggcggagtatagacgaatccgtccagg
cggaagcgataagtatcaggccgggaatggcggtgaggtaacctgcgagtgataaatcca
aaggtaagccgtgccacatgacactaaaataatcaccgaaagaaacatcggcgtataaat
catggtagtagaccatgaagaccggcttttgaagaacaaacaagaggacaaataaaaagt
atgtcgtgaaaaattggataattctctttttcataatgtgtaaacttaaaataattgaac
ggatacaaagttagtatacttttcgttatctttctcatgatgtaatataaaacatctctt
ttttttccatatctttgtcgtgtgtgtgacaaaaattaagtaatgaaatggctaagattg
cgaagaaactaacagatttagtggggaatactcctctgatggagctttccggttattgtg
gtaagtatggtctggaacaaaatattattgccaaactggaggcctttaatccggcgggaa
gtgtgaaagacagggtggctctttcgatgattgaagatgcggaggcacgtggggtattga
agcccggcgcaacgataatcgaaccgacaagcggaaatacaggtgtcggactggcaatgg
tcgctaccatcaaaggatatcacctgatattgacaatgcctgagacgatgagtctggaac
ggcgtaacctgttgaaagcactcggtgcggaaatcgttctgacagacggcttgggcggaa
tggcggcttccattgcaaaggctgaggaattgcgagacagtattcccggttcggtgattc
tgcaacaatttgagaatccagccaatgcggcggcgcatgagcgtacgacaggagaagaaa
tctggcgggatacagatggtgaagtagacgtttttgttgccggagtcggcaccggaggaa
cggtttgcggtgtagcccgtgctttaaagaaacataatcccgatatttatatcgtagcgg
tagaaccggctgcgtctcctgtattggaaggtggacaggcggctccacaccgtattcagg
gaatcggagccaattttattcctaaactttatgatgcttctatgatagacgaagttatcg
gtgtgcctgatgatgaagcgattcgtgcaggacgtgagctatcggcaacggaaggcttgt
tgaccggaatttcttcgggagcagctgtgtatgcagcccgtcaactagcacagcgtccgg
aatttaaaaacaaaaagatagtggcgttgttacctgatacgggagagcgttatttgtcaa
cggaattgtttgcatttgacgcatatccgttggactgattttgatttataaatactaaaa
agacttgaaccatggtaagaacgattattgctttatttttctgtttcccggttgccttgt
atgcgcaaacttatcagcaattgtccgaaagggctattgactgtatcgaaaaagacagtc
ttccacaagcggaagaacttttgcttcgtgctttgaaactggaaccgaaaaatgcgaaga
atgcgttgctcttttccaatctgggattggtacaacgtcgtttgggagagtttgataagg
cactcgaatcttattcttttgccttgaactttgctccattggcagttcctattttgttgg
accgtgccgccatctatatggaaatgggaaagacagatcgcgcttatactgattattgcc
aggtgcttgacggggataagcaaaataaggaagccttattgatgcgtgcgtatatttatg
tactccgcagggattatccggctgcccgtattgattataatcgtttattggaacttga


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search