The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|457424.5.peg.3487: Bacteroides fragilis 3_1_12

This feature in The SEED Viewer

NCBI Taxonomy Id: 457424

Current Assignment: Cysteine synthase (EC 2.5.1.47)
Translate Function Assignments



Context on contig NZ_EQ973215 from base 678749 to 692109 (13361 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
3482 680779 678749 2031 -           Dipeptidyl-peptidase III (EC 3.4.14.4)  
3483 681359 680895 465 - 115         Transcriptional regulator, AraC/XylS family  
3484 681593 683398 1806 + 233     5: 13 16 2 14 11   ATP-dependent DNA helicase RecQ  
3485 683508 683714 207 + 109         hypothetical protein  
3486 684662 683793 870 - 78         TPR-repeat-containing protein  
3487 685745 684795 951 - 132     9: 5 6 3 10 17 12 9 15 4   Cysteine synthase (EC 2.5.1.47)  
3488 685914 687674 1761 + 168         putative sulfatase  
3489 687698 688363 666 + 23         putative membrane-associated phospholipid phosphatase  
3490 688458 688342 117 - -22         hypothetical protein  
3491 688556 688942 387 + 97     3: 1 8 7   cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases  
3492 689046 690296 1251 + 103         ADP-ribose pyrophosphatase  
3493 690320 690457 138 + 23         hypothetical protein  
3494 692109 690490 1620 - 32         Putative outer membrane protein, probably involved in nutrient binding  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Cysteine_Biosynthesis OlgaZ Cysteine synthase (EC 2.5.1.47)
Experimental_Sulfur_transfer_Archaea vcrecy Cysteine synthase (EC 2.5.1.47)
CLO_Cysteine Lerma-Ortiz_Claudia_user Cysteine synthase (EC 2.5.1.47)
Methionine_Biosynthesis rodionov Cysteine synthase (EC 2.5.1.47)
Cysteine_biosynthesis_HGM Cysteine synthase (EC 2.5.1.47)
Cysteine_biosynthesis_HGM_2 Ravcheev_Dmitry_user Cysteine synthase (EC 2.5.1.47)
Proline Cysteine synthase (EC 2.5.1.47)
Fermentation_of_amino_acids_HGM_2 Cysteine synthase (EC 2.5.1.47)
Cysteine_biosynthesis_PanGenomes Acharya_Geeta_user Cysteine synthase (EC 2.5.1.47)


  Protein Sequence

>fig|457424.5.peg.3487 Cysteine synthase (EC 2.5.1.47)
MAKIAKKLTELIGHTPLMELSGYSRKYGLEENIIAKLESFNPAGSVKDRVALSMIEDAEK
RGVLKPGATIIEPTSGNTGVGLAMVATIKGYQLILTMPETMSLERRNLLKALGAQIVLTD
GLAGMAGSIAKAEELKDSIPGSVILQQFENPSNAEVHTRFTGEEIWQDTDGQVAVFVAGV
GTGGTVCGVARALKKHNPDVYIVAVEPASSPVLEGGKAAPHRIQGIGANFVPGIYDASVV
DEIMPVPDDEAIRGGRELASTEGLLAGISSGAVVYAARKLAERPEFKGKRIVALLPDTGE
RYLSTELFAFDAYPLD

MD5 = ca34bdab4f782499b386c40a749eac46


  DNA Sequence

>fig|457424.5.peg.3487 Cysteine synthase (EC 2.5.1.47)
atggcaaaaatcgcaaagaaacttaccgaactgataggccatactccgttgatggagttg
tccggttatagtcgtaaatacggcctggaagagaatattatcgctaaactggagtcattt
aaccctgccgggagcgtaaaggaccgggtggcactttcgatgatcgaggatgccgagaag
agaggagttctgaagcccggtgccacgatcatcgagccgaccagcggaaataccggtgtg
ggactggccatggtggctaccattaaagggtatcagttgatattgaccatgcccgaaacg
atgagtctggaacgtcgcaatctgttgaaagcactgggagcacaaattgtattgactgac
gggttggcaggaatggccggttccatagccaaagctgaggaactgaaagactcgatcccc
ggttcggtcattctgcaacagtttgagaatccttcgaatgcggaggtgcacacacgcttc
accggcgaagagatctggcaggacactgacggacaggtggctgtgtttgtagcgggagta
ggaacgggcggaaccgtttgcggggtggcccgtgcactgaaaaagcataatccggatgta
tatatagtagctgtggaaccggcatcgtctcccgtacttgaaggcgggaaggccgctccc
caccgtatacaagggattggggcgaattttgttcccggtatttacgatgcttcggttgta
gacgaaatcatgcctgtgcctgacgatgaggcgatccgtggtgggcgtgaattggcttct
acggaaggactgttggcggggatttcttccggagccgttgtttatgcagcccgcaagctg
gccgaacgtccggagtttaaaggaaagaggatcgtggctttattgcccgacaccggcgag
cgttatctctctaccgagttatttgcgtttgacgcttatcctctggattaa


  DNA with Flanking Sequence

>fig|457424.5.peg.3487 Cysteine synthase (EC 2.5.1.47)
attacgacccaaatgctgacactggccaatgcgtctttgggagaagaaaagaggtaaaaa
agcggggtggcatccagacggaatccccagtattcatataaccctaagtcgccgataaag
atacaggatagcaggatggctatgatcatgaagtatacccggcgtatctggcggataatg
gaaggttgtatccagaccgaagcgatcagcaatagtccgggaatagcggtcagataaccg
gcaagcgaaaggtccaacggaagcccgtgccctatcacggagaaataatcagtccatgac
accttattatataaggtatggtagtaacccatgaaaattggtttctggaggacgaatatg
aggacaaaaagaaaataagtcgtgacgaattggataagtcttctcttcataaactctata
cttaaaaagattgaacggtcacaaaggtacgattcttttctttatctttgcgcattaact
gtggtaaaacagagagctatatggcaaaaatcgcaaagaaacttaccgaactgataggcc
atactccgttgatggagttgtccggttatagtcgtaaatacggcctggaagagaatatta
tcgctaaactggagtcatttaaccctgccgggagcgtaaaggaccgggtggcactttcga
tgatcgaggatgccgagaagagaggagttctgaagcccggtgccacgatcatcgagccga
ccagcggaaataccggtgtgggactggccatggtggctaccattaaagggtatcagttga
tattgaccatgcccgaaacgatgagtctggaacgtcgcaatctgttgaaagcactgggag
cacaaattgtattgactgacgggttggcaggaatggccggttccatagccaaagctgagg
aactgaaagactcgatccccggttcggtcattctgcaacagtttgagaatccttcgaatg
cggaggtgcacacacgcttcaccggcgaagagatctggcaggacactgacggacaggtgg
ctgtgtttgtagcgggagtaggaacgggcggaaccgtttgcggggtggcccgtgcactga
aaaagcataatccggatgtatatatagtagctgtggaaccggcatcgtctcccgtacttg
aaggcgggaaggccgctccccaccgtatacaagggattggggcgaattttgttcccggta
tttacgatgcttcggttgtagacgaaatcatgcctgtgcctgacgatgaggcgatccgtg
gtgggcgtgaattggcttctacggaaggactgttggcggggatttcttccggagccgttg
tttatgcagcccgcaagctggccgaacgtccggagtttaaaggaaagaggatcgtggctt
tattgcccgacaccggcgagcgttatctctctaccgagttatttgcgtttgacgcttatc
ctctggattaaaaagcacactcgtgcttgtctgacattttaatatatatgaaccggagat
cggcctctgaccgatctgtggagaaagaaactgtatgttcagcgtatactccccattacc
ggttcgtttttaatagattatttatgaatcgaaaaactatcattgttccctttcctttgg
gagaggggatagggaggaagtatctttttctccttcttttctccatcttttccatatccc
tttccgctcagacctatcaggaactttccgagaaggccgtcgagtgtgttggaaaagaca
gtctggcgcaagccgaagatcttttgaagcaggcattgagactggaaccgaagaaccccc
ataatgctctgttgttttctaatctcggcttggtgcaacgcaagctgggacgttataatg
atgctgtcgagtcgtatacttatgcactcaacattgcgccgctcgccgtgcccattttgc
tgaaccgtgccgccatctatctggagcaggg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
gi|255010915 Bacteroides fragilis 3_1_12 NCBI   putative cysteine synthase
ref|ZP_05283041.1 Bacteroides fragilis 3_1_12 RefSeq   putative cysteine synthase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search