The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.969: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: ClpB protein
Translate Function Assignments



Context on contig NC_007793 from base 957595 to 970545 (12951 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
965 958911 957595 1317 -           CoA-disulfide reductase (EC 1.8.1.14) gene_name|cdr, locus|SAUSA300_0873, protein_id|YP_493573.1, gi|87161053, geneID|3912763
966 959787 958963 825 - 51     1: 1   5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase (EC 3.1.3.104) locus|SAUSA300_0874, protein_id|YP_493574.1, gi|87162380, geneID|3913533
967 959901 960209 309 + 113         PaaD-like protein (DUF59) involved in Fe-S cluster assembly locus|SAUSA300_0875, protein_id|YP_493575.1, gi|87161816, geneID|3914652
968 960756 962570 1815 + 546         Acyltransferase locus|SAUSA300_0876, protein_id|YP_493576.1, gi|87160550, geneID|3913505
969 962773 965382 2610 + 202     3: 4 2 3   ClpB protein gene_name|clpB, locus|SAUSA300_0877, protein_id|YP_493577.1, gi|87160081, geneID|3913305
970 966310 965441 870 - 58         LysR family regulatory protein locus|SAUSA300_0878, protein_id|YP_493578.1, gi|87160854, geneID|3913400
971 966420 967565 1146 + 109         FIG01108309: hypothetical protein locus|SAUSA300_0879, protein_id|YP_493579.1, gi|87160295, geneID|3914531
972 967549 968190 642 + -17     8: 5 6 11 8 12 10 9 7   Threonylcarbamoyl-AMP synthase-like protein locus|SAUSA300_0880, protein_id|YP_493580.1, gi|87161016, geneID|3913932
973 968183 969301 1119 + -8         Putative uncharacterized protein MW0861 locus|SAUSA300_0881, protein_id|YP_493581.1, gi|87160454, geneID|3913055
974 969285 969800 516 + -17         Phospholipid-binding protein locus|SAUSA300_0882, protein_id|YP_493582.1, gi|87162199, geneID|3914842
975 970111 970545 435 + 310         Similar to cell surface protein Map-w locus|SAUSA300_0883, protein_id|YP_493583.1, gi|87161594, geneID|3914378

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Proteolysis_in_bacteria,_ATP-dependent OlgaZ ClpB protein
Protein_chaperones gjo ClpB protein
Protein_Carbonylation ClpB protein


  Protein Sequence

>fig|451515.3.peg.969 ClpB protein
MDINKMTYAVQSALQQAVELSQQHKLQNIEIEAILSAALNESESLYKSILERANIEVDQL
NKAYEDKLNTYASVEGDNIQYGQYISQQANQLITKAESYMKEYEDEYISMEHILRSAMDI
DQTTKHYINNKVEVIKEIIKKVRGGNHVTSQNPEVNYEALAKYGRDLVEEVRQGKMDPVI
GRDEEIRNTIRILSRKTKNNPVLIGEPGVGKTAIVEGLAQRIVKKDVPESLLDKTVFELD
LSALVAGAKYRGEFEERLKAVLKEVKESDGRIILFIDEIHMLVGAGKTDGAMDAGNMLKP
MLARGELHCIGATTLNEYREYIEKDSALERRFQKVAVSEPDVEDTISILRGLKERYEVYH
GVRIQDRALVAAAELSDRYITDRFLPDKAIDLVDQACATIRTEMGSNPTELDQVNRRVMQ
LEIEESALKNESDNASKQRLQELQEELANEKEKQAALQSRVESEKEKIANLQEKRAQLDE
SRQALEDAQTNNNLEKAAELQYGTIPQLEKELRELEDNFQDEQGEDTDRMIREVVTDEEI
GDIVSQWTGIPVSKLVETEREKLLHLSDILHKRVVGQDKAVDLVSDAVVRARAGIKDPNR
PIGSFLFLGPTGVGKTELAKSLAASLFDSEKHMIRIDMSEYMEKHAVSRLIGAPPGYIGH
DEGGQLTEAVRRNPYSVILLDEVEKAHTDVFNVLLQILDEGRLTDSKGRSVDFKNTIIIM
TSNIGSQVLLENVKETGEITESTEKAVMTSLNAYFKPEILNRMDDIVLFKPLSIDDMSMI
VDKILTQLNIRLLEQRISIEVSDDAKAWLGQEAYEPQYGARPLKRFVQRQIETPLARMMI
KEGFPEGTTIKVNLNSDNNLTFNVEKIHE

MD5 = 5459ce52c6f1c5bf31bd8ba58cddf8ab


  DNA Sequence

>fig|451515.3.peg.969 ClpB protein
atggatataaataaaatgacatatgctgttcaaagtgctttacaacaagcagttgaactg
agtcagcaacataaattacaaaatatagaaattgaggcaattttaagcgctgccttaaat
gaaagtgaaagcttatataaaagtattttagaacgagcaaatattgaggtagatcaatta
aacaaagcttatgaagacaaactaaacacgtatgcatctgtagaaggtgacaatatacaa
tatggtcaatatattagccaacaagcaaaccaattgataactaaggctgaatcatacatg
aaagaatatgaagatgaatatatttcaatggagcatattttacgttcggcaatggacatt
gatcaaacaacaaaacattatataaataataaagtagaagttatcaaagaaattattaaa
aaagtaagagggggaaatcacgtgacatcacaaaatccagaagttaattacgaagcatta
gctaaatatggccgcgacttagtagaagaagttagacaaggtaaaatggatcctgttata
ggaagagatgaagaaattcgaaatacgattcgtattttaagtcgtaaaactaaaaacaac
cctgtgctcattggtgaaccaggtgttggtaaaactgcaattgttgaaggattagcgcaa
cgtatagttaagaaagatgtgccagaatcattattagataaaactgtttttgagttagat
ttaagcgcattagtagcgggcgctaaatatcgtggtgaatttgaagagagattaaaagca
gtcctaaaagaagttaaagagtctgatggtagaattatattatttattgatgaaatccat
atgcttgtaggtgctggtaaaacagatggtgccatggatgcaggcaacatgctaaaacca
atgttagcacgaggagagttacattgtattggtgcaacaactttaaatgaatatcgagaa
tatattgaaaaagattcggcattagagcgtcgtttccaaaaagtagcagttagtgagcct
gatgttgaagatacaatttcaattttacgtggtttaaaagaacgatatgaagtgtatcat
ggtgtgcgtattcaagatagagccttagttgctgccgctgaattgtctgatcgttacatc
actgatcgttttttaccagataaagcgattgatttagttgaccaagcatgtgcaacaatt
cgtacggaaatgggatcaaatccaactgaattggatcaagttaatagacgtgtcatgcaa
ttagaaattgaagaaagcgcacttaaaaatgaatctgacaatgcgagcaaacagagatta
caagaactacaagaagagcttgccaatgaaaaagagaaacaagcagcacttcaatctcgt
gtagaatcagaaaaagaaaaaatagcaaatttacaagaaaaacgtgcgcaactagatgaa
agtagacaagcgttggaagatgcacaaacaaataacaatttagaaaaagctgctgaacta
caatatggaacaattcctcaattggaaaaagaacttagagaattagaggataatttccaa
gatgagcaaggtgaagatacagatcgaatgattcgtgaagttgtaacagacgaagaaatt
ggcgatattgtcagccaatggacaggcataccagtttcaaaattagttgaaacagaacgt
gaaaaattacttcacttaagtgacatcttgcataaacgtgttgtaggtcaagataaagcg
gttgacctggtttcagatgcagtagttagagcaagagcaggtattaaagatccaaacaga
cctattggtagtttcttattcctaggtccaactggagtaggtaaaactgaattagctaaa
tcattagctgcatcattatttgattctgaaaaacatatgattcgtattgatatgagtgaa
tatatggaaaaacatgcagtatcaagattgataggggcacctccaggatatattggacat
gatgaagggggtcaattaactgaagcggttcgtcgtaatccatactcagttattttatta
gatgaggttgaaaaagcgcatactgacgtctttaatgtattattgcaaattttagatgaa
ggccgtttaactgattctaaaggacgtagcgttgattttaaaaatactattattattatg
acaagtaatattggatctcaagttttattagaaaacgtaaaagagactggtgaaattaca
gaatcaacagaaaaagctgttatgacaagtttaaatgcatatttcaaaccagaaattttg
aatcgtatggatgatatcgtattatttaaaccattatctattgatgacatgagtatgatt
gtagataaaatcttaacgcaattaaatataagattattagaacaacgaatctcaattgaa
gtttctgatgatgctaaagcttggctaggtcaagaagcttatgaacctcaatacggtgca
agaccattaaaacgttttgtacaacgccaaattgaaacaccattagcacgtatgatgatt
aaagagggattcccagaaggtacaacgattaaagttaatttaaattcagacaataactta
acgtttaatgttgaaaaaattcatgaataa


  DNA with Flanking Sequence

>fig|451515.3.peg.969 ClpB protein
cgtattagaattaggtacaaatggcgactttactgtcaaacagctcgacgatttacttaa
tcaatttggaaaagccaagatttatttagttaatacacgtgttccaagaatttatgaggc
aaatgtaaatcgattattagctgacgcggcgaaacgaaagtccaatgtcacattaattga
ttggtataagcgatcacaaggacatagtgaatattttgcaccagacggtgtacatttaga
gtacaaaggagtcctagctttaaaagatgaaatattaaaagcacttaaaaagaaataaca
tatgtttaataagtctagttaatgtgtaacgtaacattagctagatttttttattcaaaa
aaatatttacaaatattaggaaatttaagtgtaaaagagttgataaatgattatattggg
actataatataattaaggtcaaagaaagtcaaagtcaaaagtgcaacttgaccaactcta
caaattagaggtgaaattatatggatataaataaaatgacatatgctgttcaaagtgctt
tacaacaagcagttgaactgagtcagcaacataaattacaaaatatagaaattgaggcaa
ttttaagcgctgccttaaatgaaagtgaaagcttatataaaagtattttagaacgagcaa
atattgaggtagatcaattaaacaaagcttatgaagacaaactaaacacgtatgcatctg
tagaaggtgacaatatacaatatggtcaatatattagccaacaagcaaaccaattgataa
ctaaggctgaatcatacatgaaagaatatgaagatgaatatatttcaatggagcatattt
tacgttcggcaatggacattgatcaaacaacaaaacattatataaataataaagtagaag
ttatcaaagaaattattaaaaaagtaagagggggaaatcacgtgacatcacaaaatccag
aagttaattacgaagcattagctaaatatggccgcgacttagtagaagaagttagacaag
gtaaaatggatcctgttataggaagagatgaagaaattcgaaatacgattcgtattttaa
gtcgtaaaactaaaaacaaccctgtgctcattggtgaaccaggtgttggtaaaactgcaa
ttgttgaaggattagcgcaacgtatagttaagaaagatgtgccagaatcattattagata
aaactgtttttgagttagatttaagcgcattagtagcgggcgctaaatatcgtggtgaat
ttgaagagagattaaaagcagtcctaaaagaagttaaagagtctgatggtagaattatat
tatttattgatgaaatccatatgcttgtaggtgctggtaaaacagatggtgccatggatg
caggcaacatgctaaaaccaatgttagcacgaggagagttacattgtattggtgcaacaa
ctttaaatgaatatcgagaatatattgaaaaagattcggcattagagcgtcgtttccaaa
aagtagcagttagtgagcctgatgttgaagatacaatttcaattttacgtggtttaaaag
aacgatatgaagtgtatcatggtgtgcgtattcaagatagagccttagttgctgccgctg
aattgtctgatcgttacatcactgatcgttttttaccagataaagcgattgatttagttg
accaagcatgtgcaacaattcgtacggaaatgggatcaaatccaactgaattggatcaag
ttaatagacgtgtcatgcaattagaaattgaagaaagcgcacttaaaaatgaatctgaca
atgcgagcaaacagagattacaagaactacaagaagagcttgccaatgaaaaagagaaac
aagcagcacttcaatctcgtgtagaatcagaaaaagaaaaaatagcaaatttacaagaaa
aacgtgcgcaactagatgaaagtagacaagcgttggaagatgcacaaacaaataacaatt
tagaaaaagctgctgaactacaatatggaacaattcctcaattggaaaaagaacttagag
aattagaggataatttccaagatgagcaaggtgaagatacagatcgaatgattcgtgaag
ttgtaacagacgaagaaattggcgatattgtcagccaatggacaggcataccagtttcaa
aattagttgaaacagaacgtgaaaaattacttcacttaagtgacatcttgcataaacgtg
ttgtaggtcaagataaagcggttgacctggtttcagatgcagtagttagagcaagagcag
gtattaaagatccaaacagacctattggtagtttcttattcctaggtccaactggagtag
gtaaaactgaattagctaaatcattagctgcatcattatttgattctgaaaaacatatga
ttcgtattgatatgagtgaatatatggaaaaacatgcagtatcaagattgataggggcac
ctccaggatatattggacatgatgaagggggtcaattaactgaagcggttcgtcgtaatc
catactcagttattttattagatgaggttgaaaaagcgcatactgacgtctttaatgtat
tattgcaaattttagatgaaggccgtttaactgattctaaaggacgtagcgttgatttta
aaaatactattattattatgacaagtaatattggatctcaagttttattagaaaacgtaa
aagagactggtgaaattacagaatcaacagaaaaagctgttatgacaagtttaaatgcat
atttcaaaccagaaattttgaatcgtatggatgatatcgtattatttaaaccattatcta
ttgatgacatgagtatgattgtagataaaatcttaacgcaattaaatataagattattag
aacaacgaatctcaattgaagtttctgatgatgctaaagcttggctaggtcaagaagctt
atgaacctcaatacggtgcaagaccattaaaacgttttgtacaacgccaaattgaaacac
cattagcacgtatgatgattaaagagggattcccagaaggtacaacgattaaagttaatt
taaattcagacaataacttaacgtttaatgttgaaaaaattcatgaataaaattgaacca
agaatgtgatgattaatcgcattcttggttttttagatttgaaatttattataattgttc
attggcaatatactttttaaatgatttaataaacaccaatatttctgggctttctttttt
gctgtatatatatgtaaatgaaataggtgcttgtaaaattttcgtgttaataaccgaaat
attgtaatcactatttgttgttatataaagaggcaggaatgatataccttgattcatttc
gattaatttaattgaagtatgcacatcattgatagatagaaattgtgctttttcataaat
atttaaaatattatttttaagtgatgaccaatattctggatggttatcacttattatttt
gtatttttcaaataaagatgcctcagttagaagatgattattctctttattgggagcaat
caatacaattttaccttcgcatactttttcagaatgaacttctcttagtttaggttgatt
tctgctaatc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005515       F:protein binding
GO:0005524       F:ATP binding
GO:0005737       C:cytoplasm
GO:0006950       P:response to stress
GO:0008233       F:peptidase activity
GO:0017111       F:nucleoside-triphosphatase activity
GO:0019538       P:protein metabolic process
cmr|NT09SA0850 Staphylococcus aureus subsp. aureus MSSA476     ClpB chaperone homologue ORFID:MW0857
cmr|SACOL0979 Staphylococcus aureus subsp. aureus COL     ATP-dependent Clp protease, ATP-binding subunit ClpB
cmr|SAUSA300_0877 Staphylococcus aureus subsp. aureus USA300-FPR3757     Chaperone clpB
dbj|BAF67117.1 Staphylococcus aureus subsp. aureus str. Newman     ATP-dependent Clp protease, ATP-binding subunit ClpB
emb|CAG42620.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative ATPase subunit of an ATP-dependent protease
fig|282459.1.peg.839 Staphylococcus aureus subsp. aureus MSSA476 FIG   ClpB protein
fig|282459.5.peg.881 Staphylococcus aureus subsp. aureus MSSA476 FIG   ClpB protein
fig|367830.3.peg.955 Staphylococcus aureus subsp. aureus USA300 FIG   ClpB protein
fig|426430.6.peg.824 Staphylococcus aureus subsp. aureus str. Newman FIG   ClpB protein
fig|426430.8.peg.918 Staphylococcus aureus subsp. aureus str. Newman FIG   ClpB protein
fig|450394.6.peg.167 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   ClpB protein
fig|451516.9.peg.974 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   ClpB protein
fig|452948.4.peg.1286 Staphylococcus aureus 930918-3 FIG   ClpB protein
fig|455227.3.peg.1332 Staphylococcus aureus D30 FIG   ClpB protein
fig|548474.3.peg.1344 Staphylococcus aureus subsp. aureus TCH130 FIG   ClpB protein
fig|553590.4.peg.17 Staphylococcus aureus A9754 FIG   ClpB protein
fig|553594.3.peg.1267 Staphylococcus aureus A9765 FIG   ClpB protein
fig|644279.4.peg.978 Staphylococcus aureus subsp. aureus 132 FIG   ClpB protein
fig|762962.3.peg.1095 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   ClpB protein
fig|93062.19.peg.954 Staphylococcus aureus subsp. aureus COL FIG   ClpB protein
fig|93062.4.peg.1130 Staphylococcus aureus subsp. aureus COL FIG   ClpB protein
gb|AAW37946.1 Staphylococcus aureus subsp. aureus COL     ATP-dependent Clp protease, ATP-binding subunit ClpB
gb|ABD20569.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     Chaperone clpB
gb|ABX28954.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     S14 family endopeptidase ClpB
gb|EES93309.1 Staphylococcus aureus subsp. aureus USA300_TCH959     S14 family endopeptidase ClpB
gb|EES98175.1 Staphylococcus aureus subsp. aureus TCH130     S14 family endopeptidase ClpB
gb|EEW45001.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1469
gb|EEW47125.1 Staphylococcus aureus D30     hypothetical protein SAD30_1623
gi|150373857 Staphylococcus aureus subsp. aureus str. Newman NCBI   ATP-dependent Clp protease, ATP-binding subunit ClpB
gi|151221057 Staphylococcus aureus subsp. aureus str. Newman NCBI   ATP-dependent Clp protease, ATP-binding subunit ClpB
gi|160367983 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   S14 family endopeptidase ClpB
gi|161509174 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   endopeptidase ClpB
gi|253724580 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   S14 family endopeptidase ClpB
gi|253729446 Staphylococcus aureus subsp. aureus TCH130 NCBI   S14 family endopeptidase ClpB
gi|253731581 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   S14 family endopeptidase ClpB
gi|253732668 Staphylococcus aureus subsp. aureus TCH130 NCBI   S14 family endopeptidase ClpB
gi|259159965 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1469
gi|259162557 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1623
gi|49244194 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative ATPase subunit of an ATP-dependent protease
gi|49485751 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative ATPase subunit of an ATP-dependent protease
gi|57285852 Staphylococcus aureus subsp. aureus COL NCBI   ATP-dependent Clp protease, ATP-binding subunit ClpB
gi|57651666 Staphylococcus aureus subsp. aureus COL NCBI   ATP-dependent Clp protease, ATP-binding subunit ClpB
gi|81649655 organism not parsed/found in ncbi nr NCBI   RecName: Full=Chaperone protein clpB
gi|81694855 organism not parsed/found in ncbi nr NCBI   RecName: Full=Chaperone protein clpB
gi|87126055 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   Chaperone clpB
gi|87160081 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   chaperone clpB
img|637151744 Staphylococcus aureus aureus COL IMG   ATP-dependent Clp protease, ATP-binding subunit ClpB
img|637157073 Staphylococcus aureus aureus MSSA476 IMG   putative ATPase subunit of an ATP-dependent protease
img|637887529 Staphylococcus aureus aureus USA300 IMG   Chaperone clpB
img|640795223 Staphylococcus aureus aureus Newman IMG   ATP-dependent Clp protease, ATP-binding subunit ClpB
img|641308902 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   S14 family endopeptidase ClpB( EC:3.4.21.92 )
img|641771775 Staphylococcus aureus aureus USA300_TCH959 IMG   S14 family endopeptidase ClpB
kegg|saa:SAUSA300_0877 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   chaperone ClpB
kegg|sac:SACOL0979 Staphylococcus aureus subsp. aureus COL KEGG   ATP-dependent Clp protease, ATP-binding subunit ClpB
kegg|sae:NWMN_0845 Staphylococcus aureus subsp. aureus Newman KEGG   ATP-dependent Clp protease, ATP-binding subunit ClpB
kegg|sas:SAS0845   KEGG   putative ATPase subunit of an ATP-dependent protease
kegg|sax:USA300HOU_0933 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   endopeptidase ClpB (EC:3.4.21.92)
ref|YP_001331879.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   ATP-dependent Clp protease, ATP-binding subunit ClpB
ref|YP_001574833.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   endopeptidase ClpB
ref|YP_042972.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   putative ATPase subunit of an ATP-dependent protease
ref|YP_185847.1 Staphylococcus aureus subsp. aureus COL RefSeq   ATP-dependent Clp protease, ATP-binding subunit ClpB
ref|YP_493577.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   chaperone clpB
ref|ZP_04865746.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   S14 family endopeptidase ClpB
ref|ZP_04866833.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   S14 family endopeptidase ClpB
sp|CLPB_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Chaperone protein clpB
sp|CLPB_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=Chaperone protein clpB
sp|Q5HHB0 Staphylococcus aureus (strain COL) SwissProt   Chaperone protein clpB
sp|Q6GAV1 Staphylococcus aureus (strain MSSA476) SwissProt   Chaperone protein clpB
tr|A6QFI5 Staphylococcus aureus (strain Newman) TrEMBL   ATP-dependent Clp protease, ATP-binding subunit ClpB
tr|A8Z080 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   S14 family endopeptidase ClpB
tr|C5N454 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   S14 family endopeptidase ClpB
tr|C5PY55 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   S14 family endopeptidase ClpB
tr|Q2FIA1 Staphylococcus aureus (strain USA300) TrEMBL   Chaperone clpB


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search