The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.923: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
Translate Function Assignments



Context on contig NC_007793 from base 907497 to 919011 (11515 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
916 907497 908324 828 +           UPF0721 transmembrane protein YunE locus|SAUSA300_0827, protein_id|YP_493527.1, gi|87159978, geneID|3914830
917 908351 909670 1320 + 26     2: 10 6   5'-nucleotidase family protein in cluster with NagD-like phosphatase locus|SAUSA300_0828, protein_id|YP_493528.1, gi|87162282, geneID|3915322
918 909754 910671 918 + 83     5: 7 8 5 13 9   Lipoyl synthase (EC 2.8.1.8) gene_name|lipA, locus|SAUSA300_0829, protein_id|YP_493529.1, gi|87161551, geneID|3914679
919 910801 911184 384 + 129         Hypothetical DUF1027 domain protein locus|SAUSA300_0830, protein_id|YP_493530.1, gi|87161452, geneID|3914125
920 911529 911263 267 - 78         hypothetical protein locus|SAUSA300_0831, protein_id|YP_493531.1, gi|87160856, geneID|3913402
921 911627 912061 435 + 97         BH3430 unknown conserved protein locus|SAUSA300_0832, protein_id|YP_493532.1, gi|87159946, geneID|3913833
922 912061 912840 780 + -1         Hypothetical NagD-like phosphatase locus|SAUSA300_0833, protein_id|YP_493533.1, gi|87160369, geneID|3913243
923 912873 913832 960 + 32     2: 12 11   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81) locus|SAUSA300_0834, protein_id|YP_493534.1, gi|87162234, geneID|3914859
924 914244 914396 153 + 411         Component involved in D-alanylation of teichoic acids  
925 914412 915869 1458 + 15     3: 3 1 2   D-alanine--poly(phosphoribitol) ligase subunit 1 (EC 6.1.1.13) gene_name|dltA, locus|SAUSA300_0835, protein_id|YP_493535.1, gi|87161647, geneID|3913697
926 915866 917080 1215 + -4     2: 1 2   D-alanyl transfer protein DltB gene_name|dltB, locus|SAUSA300_0836, protein_id|YP_493536.1, gi|87160825, geneID|3913546
927 917098 917334 237 + 17     3: 3 1 2 dlit(10085071) D-alanine--poly(phosphoribitol) ligase ACP subunit (EC 6.1.1.13) gene_name|dltC, locus|SAUSA300_0837, protein_id|YP_493537.1, gi|87160121, geneID|3912974
928 917331 918506 1176 + -4     2: 1 2   Poly(glycerophosphate chain) D-alanine transfer protein DltD gene_name|dltD, locus|SAUSA300_0838, protein_id|YP_493538.1, gi|87160697, geneID|3914191
929 919011 918769 243 - 262     1: 4   NifU-C-terminal domain-like protein YutI locus|SAUSA300_0839, protein_id|YP_493539.1, gi|87159950, geneID|3913837

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Glycerate_metabolism rodionov Hydroxypyruvate reductase (EC 1.1.1.81)
Glycolate,_glyoxylate_interconversions SvetaG Glyoxylate reductase (EC 1.1.1.26)
Glycolate,_glyoxylate_interconversions SvetaG Glyoxylate reductase (EC 1.1.1.79)
Glycolate,_glyoxylate_interconversions SvetaG Hydroxypyruvate reductase (EC 1.1.1.81)


  Protein Sequence

>fig|451515.3.peg.923 Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
MVKIVVSRKIPDKFYQQLSKLGDVVMWQKSLVPMPKDQFVTALRDADACFITLSEQIDAE
ILAQSPNLKVIANMAVGYDNIDVESATANNVVVTNTPNVLTETTAELGFTLMLAIARRIV
EAEKYVEADAWQSWGPYLLSGKDVFNSTIGIYGMGDIGKAFARRLQGFNTNILYHNRSRH
KDAEADFNATYVSFETLLAESDFIICTAPLTKETHHKFNAEAFEQMKNDAIFINIGRGQI
VDETALIDALDNKEILACGLDVLANEPIDHTHPLMGRDNVLITPHIGSASVTTRDNMIQL
CINNIEAVMTNQVPHTPVN

MD5 = 5be053c9faebcd33d7a640442eb99ff2


  DNA Sequence

>fig|451515.3.peg.923 Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
ttggtaaaaatagttgtttcgaggaaaattccagataaattttatcaacaattaagtaaa
cttggtgacgttgttatgtggcaaaaatcattagtgcctatgcctaaagatcaatttgtg
acagcacttcgtgacgcagatgcttgttttattacattaagtgaacagatcgatgcagaa
attttagcgcaatcaccaaatttaaaagtaattgcgaatatggctgtaggatatgacaac
atcgatgttgaaagtgcaacagcgaataacgtggttgtcacgaatacaccaaatgtactt
actgaaacaactgcagaattaggatttacattaatgcttgctatagcacgccgtattgta
gaagctgaaaaatatgtagaagcagatgcatggcaaagctggggtccttatttattgtca
ggtaaagatgtcttcaattcaactattggaatatatggtatgggagatattggtaaagct
tttgcaagaaggttgcaagggtttaatactaatattctttatcataatcgatcaagacat
aaagatgcagaggcggactttaatgcaacatatgtttcttttgaaacgttgttagcagaa
agtgattttatcatctgtacagcgccacttacaaaagaaacacatcataaatttaatgct
gaagcatttgaacaaatgaaaaatgatgcaatttttattaatatcggtagaggacaaatt
gtagatgaaacagcattaatcgatgcactagacaataaagaaattttagcatgtggttta
gatgtattagcaaatgaaccgattgatcatacacatccattaatgggacgtgataatgtt
ctgattacaccacacattggtagcgcatcagtaacaacacgggacaatatgattcaatta
tgtattaataatatagaagcggttatgacaaatcaggtaccacatactccagtaaattga


  DNA with Flanking Sequence

>fig|451515.3.peg.923 Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
ggacttgtcattaaaaatgacgagcatgttgattatgtagttattggacttgacgaacaa
gttacatatgaaaagcttgcgattgcaacgttaggtgtaagaaatggtgcaacatttatt
tctacaaatcctgatgtatcaattcctaaagagcgtggtttattacctggtaatggtgct
attacaagtgttgtaagtgtatcgacaggtgtatcgccacaatttattggtaaaccagaa
ccgattattatggttaaagcattagaaattttaggattagataaatccgaagttgctatg
gtaggcgatttgtacgataccgatattatgtctggtattaacgtaggtatggatacgatt
catgtacaaacaggtgtatctacgttagaagatgtgcaaaataaaaatgtgccaccaacg
tattcttttaaagatttaaatgaagcaatagctgaattagaaaaatagatatagtcattt
tataaagtaggtgaattgatttggtaaaaatagttgtttcgaggaaaattccagataaat
tttatcaacaattaagtaaacttggtgacgttgttatgtggcaaaaatcattagtgccta
tgcctaaagatcaatttgtgacagcacttcgtgacgcagatgcttgttttattacattaa
gtgaacagatcgatgcagaaattttagcgcaatcaccaaatttaaaagtaattgcgaata
tggctgtaggatatgacaacatcgatgttgaaagtgcaacagcgaataacgtggttgtca
cgaatacaccaaatgtacttactgaaacaactgcagaattaggatttacattaatgcttg
ctatagcacgccgtattgtagaagctgaaaaatatgtagaagcagatgcatggcaaagct
ggggtccttatttattgtcaggtaaagatgtcttcaattcaactattggaatatatggta
tgggagatattggtaaagcttttgcaagaaggttgcaagggtttaatactaatattcttt
atcataatcgatcaagacataaagatgcagaggcggactttaatgcaacatatgtttctt
ttgaaacgttgttagcagaaagtgattttatcatctgtacagcgccacttacaaaagaaa
cacatcataaatttaatgctgaagcatttgaacaaatgaaaaatgatgcaatttttatta
atatcggtagaggacaaattgtagatgaaacagcattaatcgatgcactagacaataaag
aaattttagcatgtggtttagatgtattagcaaatgaaccgattgatcatacacatccat
taatgggacgtgataatgttctgattacaccacacattggtagcgcatcagtaacaacac
gggacaatatgattcaattatgtattaataatatagaagcggttatgacaaatcaggtac
cacatactccagtaaattgaaaataagtatggtttttaatcattggtaaaacaagcaaag
caattgttaaatatgttatgcttgacttgcgaatgtatatatttgcgctgatgataattc
aataacattataaactcgtcatattaatgtgatgagtttatttgattttgacgtatataa
caaaattgttatatagactgtaattgtttattgtttaaataacctttaaaatgaatgatg
ttctcaacaaagtgtatcatttacaataattgagtgatgacaaccaattactatgttgaa
tctataaaattaaaattgaatttcattatgaatatcgatataatgaattgtaaaaaacaa
attttaaaacgtattttatattgaacggtctttataaaggcgtttttactaagaacttta
agaggtgcaatatgaaatctaaaagtaaacagccacctaataaatatgttgaagcattca
aaccatatttattaacactattgtatttggcaatatttat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0008152       P:metabolic process
GO:0016616       F:oxidoreductase activity, acting on the CH-O...
GO:0051287       F:NAD binding
cmr|NT05SA0776 Staphylococcus aureus NCTC 8325     glyoxylate reductase
cmr|SACOL0932 Staphylococcus aureus subsp. aureus COL     D-isomer specific 2-hydroxyacid dehydrogenase family protein
cmr|SAUSA300_0834 Staphylococcus aureus subsp. aureus USA300-FPR3757     D-isomer specific 2-hydroxyacid dehydrogenase
dbj|BAB42030.1 Staphylococcus aureus subsp. aureus N315     SA0791
dbj|BAB57092.1 Staphylococcus aureus subsp. aureus Mu50     similar to glycerate dehydrogenase
dbj|BAF67073.1 Staphylococcus aureus subsp. aureus str. Newman     D-isomer specific 2-hydroxyacid dehydrogenase
dbj|BAF77808.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
fig|158878.1.peg.930 Staphylococcus aureus subsp. aureus Mu50 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|158878.14.peg.956 Staphylococcus aureus subsp. aureus Mu50 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|158879.1.peg.813 Staphylococcus aureus subsp. aureus N315 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|158879.11.peg.845 Staphylococcus aureus subsp. aureus N315 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|359786.13.peg.997 Staphylococcus aureus subsp. aureus JH9 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|359786.3.peg.1413 Staphylococcus aureus subsp. aureus JH9 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|359787.11.peg.980 Staphylococcus aureus subsp. aureus JH1 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|359787.3.peg.1555 Staphylococcus aureus subsp. aureus JH1 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|367830.3.peg.654 Staphylococcus aureus subsp. aureus USA300 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|418127.4.peg.851 Staphylococcus aureus subsp. aureus Mu3 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|418127.6.peg.940 Staphylococcus aureus subsp. aureus Mu3 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|426430.6.peg.782 Staphylococcus aureus subsp. aureus str. Newman FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|426430.8.peg.870 Staphylococcus aureus subsp. aureus str. Newman FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|450394.6.peg.122 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|451516.9.peg.928 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|452948.4.peg.2198 Staphylococcus aureus 930918-3 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|455227.3.peg.1663 Staphylococcus aureus D30 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|505321.3.peg.2379 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|546342.3.peg.203 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|553565.3.peg.2302 Staphylococcus aureus A5937 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|553568.3.peg.2362 Staphylococcus aureus A6224 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|553571.3.peg.2304 Staphylococcus aureus A6300 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|553573.3.peg.325 Staphylococcus aureus A8115 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|553574.3.peg.1292 Staphylococcus aureus A8117 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|553580.3.peg.875 Staphylococcus aureus A8819 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|553581.3.peg.1132 Staphylococcus aureus A9299 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|553588.3.peg.2289 Staphylococcus aureus A9719 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|553592.3.peg.111 Staphylococcus aureus A9763 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|553594.3.peg.1221 Staphylococcus aureus A9765 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|553596.3.peg.2261 Staphylococcus aureus A9781 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|553601.3.peg.781 Staphylococcus aureus A10102 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|585891.3.peg.954 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|644279.4.peg.934 Staphylococcus aureus subsp. aureus 132 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|680649.3.peg.1222 Staphylococcus aureus subsp. aureus MR1 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|681288.4.peg.893 Staphylococcus aureus subsp. aureus ED98 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|93061.5.peg.787 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|93062.19.peg.908 Staphylococcus aureus subsp. aureus COL FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
fig|93062.4.peg.1085 Staphylococcus aureus subsp. aureus COL FIG   Glyoxylate reductase (NADP+) (EC 1.1.1.79); Glyoxylate reductase (EC 1.1.1.26); Hydroxypyruvate reductase (EC 1.1.1.81)
gb|AAD21956.1 Staphylococcus aureus     unknown
gb|AAW37901.1 Staphylococcus aureus subsp. aureus COL     D-isomer specific 2-hydroxyacid dehydrogenase family protein
gb|ABD22722.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     D-isomer specific 2-hydroxyacid dehydrogenase
gb|ABQ48730.1 Staphylococcus aureus subsp. aureus JH9     D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
gb|ABR51804.1 Staphylococcus aureus subsp. aureus JH1     D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
gb|ABX28911.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     dehydrogenase
gb|EES93508.1 Staphylococcus aureus subsp. aureus USA300_TCH959     glyoxylate reductase
gb|EEV27647.1 Staphylococcus aureus A9781     glycerate dehydrogenase
gb|EEV65964.1 Staphylococcus aureus A9763     glycerate dehydrogenase
gb|EEV66713.1 Staphylococcus aureus A9719     glycerate dehydrogenase
gb|EEV72993.1 Staphylococcus aureus A9299     D-isomer specific 2-hydroxyacid dehydrogenase
gb|EEV76277.1 Staphylococcus aureus A8115     dehydrogenase
gb|EEV76962.1 Staphylococcus aureus A6300     dehydrogenase
gb|EEV79843.1 Staphylococcus aureus A6224     glycerate dehydrogenase
gb|EEV85120.1 Staphylococcus aureus A5937     glycerate dehydrogenase
gb|EEW44240.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0138
gb|EEW46840.1 Staphylococcus aureus D30     hypothetical protein SAD30_1207
gi|13700733 Staphylococcus aureus subsp. aureus N315 NCBI   SA0791
gi|14246699 Staphylococcus aureus subsp. aureus Mu50 NCBI   similar to glycerate dehydrogenase
gi|147740432 Staphylococcus aureus subsp. aureus JH9 NCBI   D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
gi|148267363 Staphylococcus aureus subsp. aureus JH9 NCBI   D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
gi|149945868 Staphylococcus aureus subsp. aureus JH1 NCBI   D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
gi|150373813 Staphylococcus aureus subsp. aureus str. Newman NCBI   D-isomer specific 2-hydroxyacid dehydrogenase
gi|150393416 Staphylococcus aureus subsp. aureus JH1 NCBI   D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
gi|151221013 Staphylococcus aureus subsp. aureus str. Newman NCBI   D-isomer specific 2-hydroxyacid dehydrogenase
gi|156721391 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156979256 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0925
gi|15923920 Staphylococcus aureus subsp. aureus Mu50 NCBI   glycerate dehydrogenase
gi|15926519 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0791
gi|160367940 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   dehydrogenase
gi|161509131 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   dehydrogenase
gi|221137216 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   dehydrogenase
gi|221141921 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   dehydrogenase
gi|253316830 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   D-isomer specific 2-hydroxyacid dehydrogenase
gi|253724779 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   glyoxylate reductase
gi|253731536 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   glyoxylate reductase
gi|255005720 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   D-isomer specific 2-hydroxyacid dehydrogenase
gi|257789307 Staphylococcus aureus A9781 NCBI   glycerate dehydrogenase
gi|257795335 Staphylococcus aureus A9781 NCBI   glycerate dehydrogenase
gi|257841523 Staphylococcus aureus A9763 NCBI   glycerate dehydrogenase
gi|257842285 Staphylococcus aureus A9719 NCBI   glycerate dehydrogenase
gi|257849010 Staphylococcus aureus A9299 NCBI   D-isomer specific 2-hydroxyacid dehydrogenase
gi|257852351 Staphylococcus aureus A8115 NCBI   dehydrogenase
gi|257854008 Staphylococcus aureus A6300 NCBI   dehydrogenase
gi|257856940 Staphylococcus aureus A6224 NCBI   glycerate dehydrogenase
gi|257862351 Staphylococcus aureus A5937 NCBI   glycerate dehydrogenase
gi|258406984 Staphylococcus aureus A9763 NCBI   glycerate dehydrogenase
gi|258421952 Staphylococcus aureus A9719 NCBI   glycerate dehydrogenase
gi|258435349 Staphylococcus aureus A9299 NCBI   D-isomer specific 2-hydroxyacid dehydrogenase
gi|258441561 Staphylococcus aureus A8115 NCBI   dehydrogenase
gi|258447260 Staphylococcus aureus A6300 NCBI   dehydrogenase
gi|258450020 Staphylococcus aureus A6224 NCBI   glycerate dehydrogenase
gi|258455533 Staphylococcus aureus A5937 NCBI   glycerate dehydrogenase
gi|259159177 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0138
gi|259162266 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1207
gi|4530240 Staphylococcus aureus NCBI   unknown
gi|57285807 Staphylococcus aureus subsp. aureus COL NCBI   D-isomer specific 2-hydroxyacid dehydrogenase family protein
gi|57651621 Staphylococcus aureus subsp. aureus COL NCBI   D-isomer specific 2-hydroxyacid dehydrogenase family protein
gi|87128208 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   D-isomer specific 2-hydroxyacid dehydrogenase
gi|87162234 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   D-isomer specific 2-hydroxyacid dehydrogenase
img|637092430 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637099443 Staphylococcus aureus aureus Mu50 IMG   similar to glycerate dehydrogenase
img|637151699 Staphylococcus aureus aureus COL IMG   D-isomer specific 2-hydroxyacid dehydrogenase family protein
img|637887486 Staphylococcus aureus aureus USA300 IMG   D-isomer specific 2-hydroxyacid dehydrogenase
img|639109542 Staphylococcus aureus aureus JH1 IMG   D-isomer specific 2-hydroxyacid dehydrogenase, catalytic region:D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
img|640565279 Staphylococcus aureus aureus JH9 IMG   D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
img|640779035 Staphylococcus aureus aureus JH1 IMG   D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
img|640795179 Staphylococcus aureus aureus Newman IMG   D-isomer specific 2-hydroxyacid dehydrogenase
img|640903666 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641308859 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   dehydrogenase
img|641772655 Staphylococcus aureus aureus USA300_TCH959 IMG   dehydrogenase
kegg|saa:SAUSA300_0834 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   D-isomer specific 2-hydroxyacid dehydrogenase
kegg|sac:SACOL0932 Staphylococcus aureus subsp. aureus COL KEGG   D-isomer specific 2-hydroxyacid dehydrogenase family protein
kegg|sae:NWMN_0801 Staphylococcus aureus subsp. aureus Newman KEGG   D-isomer specific 2-hydroxyacid dehydrogenase
kegg|sah:SaurJH1_0948 Staphylococcus aureus subsp. aureus JH1 KEGG   D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
kegg|saj:SaurJH9_0929 Staphylococcus aureus subsp. aureus JH9 KEGG   D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
kegg|sau:SA0791   KEGG   hypothetical protein
kegg|sav:SAV0930   KEGG   glycerate dehydrogenase
kegg|saw:SAHV_0925 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_0890 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   dehydrogenase
ref|NP_371454.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   glycerate dehydrogenase
ref|NP_374052.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0791
ref|YP_001246306.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
ref|YP_001316091.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
ref|YP_001331835.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   D-isomer specific 2-hydroxyacid dehydrogenase
ref|YP_001441515.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0925
ref|YP_001574790.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   dehydrogenase
ref|YP_185802.1 Staphylococcus aureus subsp. aureus COL RefSeq   D-isomer specific 2-hydroxyacid dehydrogenase family protein
ref|YP_493534.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   D-isomer specific 2-hydroxyacid dehydrogenase
ref|ZP_03562025.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   dehydrogenase
ref|ZP_03566414.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   dehydrogenase
ref|ZP_04840043.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   D-isomer specific 2-hydroxyacid dehydrogenase
ref|ZP_04865701.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   glyoxylate reductase
ref|ZP_05144321.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   D-isomer specific 2-hydroxyacid dehydrogenase
ref|ZP_05644314.1 Staphylococcus aureus A9781 RefSeq   glycerate dehydrogenase
ref|ZP_05680137.1 Staphylococcus aureus A9763 RefSeq   glycerate dehydrogenase
ref|ZP_05684873.1 Staphylococcus aureus A9719 RefSeq   glycerate dehydrogenase
ref|ZP_05689088.1 Staphylococcus aureus A9299 RefSeq   D-isomer specific 2-hydroxyacid dehydrogenase
ref|ZP_05690921.1 Staphylococcus aureus A8115 RefSeq   dehydrogenase
ref|ZP_05695409.1 Staphylococcus aureus A6300 RefSeq   dehydrogenase
ref|ZP_05698118.1 Staphylococcus aureus A6224 RefSeq   glycerate dehydrogenase
ref|ZP_05703492.1 Staphylococcus aureus A5937 RefSeq   glycerate dehydrogenase
tr|A5IRA7 Staphylococcus aureus (strain JH9) TrEMBL   D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
tr|A6QFE1 Staphylococcus aureus (strain Newman) TrEMBL   D-isomer specific 2-hydroxyacid dehydrogenase
tr|A6U036 Staphylococcus aureus (strain JH1) TrEMBL   D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
tr|A7X0D4 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|A8Z1I8 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Dehydrogenase
tr|C5N409 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Glyoxylate reductase
tr|Q2FIE4 Staphylococcus aureus (strain USA300) TrEMBL   D-isomer specific 2-hydroxyacid dehydrogenase
tr|Q5HHF5 Staphylococcus aureus (strain COL) TrEMBL   D-isomer specific 2-hydroxyacid dehydrogenase family protein
tr|Q7A2U2 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Similar to glycerate dehydrogenase
tr|Q7A6K3 Staphylococcus aureus (strain N315) TrEMBL   SA0791 protein
tr|Q9X4A4 Staphylococcus aureus TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search