The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.9: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: Replication protein
Translate Function Assignments



Context on contig NC_007792 from base 101 to 6408 (6308 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
9 101 1060 960 +           Replication protein gene_name|repA, locus|SAUSA300_pUSA030001, protein_id|YP_492687.1, gi|87159870, geneID|3912737
10 1179 1853 675 + 118         IS431mec-like transposase locus|SAUSA300_pUSA030002, protein_id|YP_492688.1, gi|87159858, geneID|3912725
11 2162 5236 3075 + 308     8: 2 7 1 3 5 4 8 6   Isoleucyl-tRNA synthetase (EC 6.1.1.5) gene_name|ileS, locus|SAUSA300_pUSA030003, protein_id|YP_492689.1, gi|87159883, geneID|3912750
12 5306 5704 399 + 69         Fructosamine-3-kinase (EC 2.7.1.-) locus|SAUSA300_pUSA030004, protein_id|YP_492690.1, gi|87159880, geneID|3912747
13 5734 6408 675 + 29         Transposase for insertion sequence-like element IS431mec # fragment locus|SAUSA300_pUSA030005, protein_id|YP_492691.1, gi|87159860, geneID|3912727

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|451515.3.peg.9 Replication protein
MSKQFFTVEENYKERFYQLPKVFFTNPNYKDLSNDAKIAYAILRDRLQLSIKNNWIDTEG
NIYFIYTVADLEVILNCGNKKITKIKKELENVDLLIQKRQGLNKPNLLYLLKPAITKNDI
YEIDKAENEVEALQDKEVSKGHVQKCQKDTSRNVKRTRLEMSKGHTNDTDFIDTDFIDTE
SNDMNNMNDTNQHSNHSNHFSNIHDKESLKYIELQELPELIKSYINNFSYEEVKSIKSVI
LKAKKSFNNKYDTFYMLEDIDEELLLVLKRFKGYLVKKQEKVANMEGYLMRSIIAELEEM
HSTIMRRKNMENNPLSLFN

MD5 = 76c1f115474dd458617d46590a849e00


  DNA Sequence

>fig|451515.3.peg.9 Replication protein
atgtctaaacaattttttacagtagaagaaaattataaagaacgcttttaccaattacct
aaagtattttttactaatcctaattataaagatttatcgaatgacgctaaaattgcttac
gcaatattgagagatcgtttacaattatctattaaaaataactggatagatacagaaggt
aacatatatttcatttatacagttgctgatttagaagtgatattaaattgtgggaacaaa
aaaatcactaaaattaaaaaagaattagaaaatgtagatttactaatccaaaaaaggcag
ggtttaaacaaaccaaatctactttatttattaaaaccagccataactaaaaatgatatt
tatgaaatagataaggctgaaaatgaagttgaggccttacaagacaaggaagtgtcaaaa
ggacacgtccagaaatgtcaaaaggacacgtctagaaatgtcaaaaggacacgtctagaa
atgtcaaaaggacacacaaatgatactgattttattgatactgattttattgatactgaa
agtaatgatatgaataatatgaatgatacaaatcaacattcaaatcattcaaatcacttt
tcaaatattcatgataaagaatctcttaaatatatagaacttcaagaactccccgaatta
attaaaagttatattaataatttcagctatgaagaagttaaaagtattaaatctgttatt
ttaaaagctaaaaaatcatttaataacaaatacgatactttctatatgttagaagatata
gatgaagaattactattggttttaaaacgatttaaaggttatcttgttaaaaaacaagaa
aaagtagctaatatggaaggttatttaatgagaagtatcattgctgaacttgaagaaatg
cactcaactattatgagaagaaaaaatatggaaaacaatccattatctctatttaattag


  DNA with Flanking Sequence

>fig|451515.3.peg.9 Replication protein
aagttatatataacggataacattatataaccttattcatcacttgtaaataacgatatt
acttaaactccttaaatatacatttaaaggagtttttatcatgtctaaacaattttttac
agtagaagaaaattataaagaacgcttttaccaattacctaaagtattttttactaatcc
taattataaagatttatcgaatgacgctaaaattgcttacgcaatattgagagatcgttt
acaattatctattaaaaataactggatagatacagaaggtaacatatatttcatttatac
agttgctgatttagaagtgatattaaattgtgggaacaaaaaaatcactaaaattaaaaa
agaattagaaaatgtagatttactaatccaaaaaaggcagggtttaaacaaaccaaatct
actttatttattaaaaccagccataactaaaaatgatatttatgaaatagataaggctga
aaatgaagttgaggccttacaagacaaggaagtgtcaaaaggacacgtccagaaatgtca
aaaggacacgtctagaaatgtcaaaaggacacgtctagaaatgtcaaaaggacacacaaa
tgatactgattttattgatactgattttattgatactgaaagtaatgatatgaataatat
gaatgatacaaatcaacattcaaatcattcaaatcacttttcaaatattcatgataaaga
atctcttaaatatatagaacttcaagaactccccgaattaattaaaagttatattaataa
tttcagctatgaagaagttaaaagtattaaatctgttattttaaaagctaaaaaatcatt
taataacaaatacgatactttctatatgttagaagatatagatgaagaattactattggt
tttaaaacgatttaaaggttatcttgttaaaaaacaagaaaaagtagctaatatggaagg
ttatttaatgagaagtatcattgctgaacttgaagaaatgcactcaactattatgagaag
aaaaaatatggaaaacaatccattatctctatttaattagtttttgaagttaaattttca
aaaaaaagagattatacacctaaaaaggtgtataatctttacggttctgttgcaaagttg
aatttatagtataattttaacaaaaaggagtcttctgtatgaactatttcagatataaac
aatttaacaaggatgttatcactgtagccgttggctactatctaagatatgcattgagct
atcgtgatatatctgaaatattaagagaacgtggtgtaaacgttcatcattcaacgatct
accgttgggttcaagaatatgccccaattttatatcaaatttggaagaaaaagcataaaa
aagcttattacaaatggcgtattgatgagacgtatatcaaaataaaaggaaaatggagct
atttatatcgtgccattgatacagagggacatacattagatatttggttgcgtaagcaac
gagataatcattcagcatatgcgtttatcaaacgtctcattaaacaatttggtaagcctc



  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|VRA0001 Staphylococcus aureus Michigan VRSA plasmids     replication initiator protein
cmr|pUSA03_0001 Staphylococcus aureus subsp. aureus USA300-FPR3757     replication initiator protein
emb|CAR62411.1 Staphylococcus aureus EMBL   putative replication initiator protein Rep
fig|367830.3.peg.9 Staphylococcus aureus subsp. aureus USA300 FIG   Replication protein
fig|553567.3.peg.2765 Staphylococcus aureus A5948 FIG   Replication protein
gb|AAC61944.1 Staphylococcus aureus     putative replication initiation protein Rep
gb|AAQ17124.1 Staphylococcus aureus     replication initiator protein
gb|ABD22963.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     replication initiator protein
gb|EEV81913.1 Staphylococcus aureus A5948     replication initiator protein
gi|226434290 Staphylococcus aureus NCBI   putative replication initiator protein Rep
gi|226464403 Staphylococcus aureus NCBI   putative replication initiator protein Rep
gi|257859052 Staphylococcus aureus A5948 NCBI   replication initiator protein
gi|258453263 Staphylococcus aureus A5948 NCBI   replication initiator protein
gi|32470399 Staphylococcus aureus NCBI   putative replication initiation protein Rep
gi|33390918 Staphylococcus aureus NCBI   replication initiator protein
gi|33416234 Staphylococcus aureus NCBI   replication initiator protein
gi|3676426 Staphylococcus aureus NCBI   putative replication initiation protein Rep
gi|87125844 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   replication initiator protein
gi|87159870 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   replication initiator protein
img|637886626 Staphylococcus aureus aureus USA300 IMG   replication initiator protein
img|640056307 Staphylococcus aureus plasmid pSK41 IMG   putative replication initiation protein Rep
img|640056343 Staphylococcus aureus plasmid pLW043 IMG   replication initiator protein
kegg|saa:SAUSA300_pUSA0301 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   replication initiator protein
ref|NP_863615.1 Staphylococcus aureus RefSeq   putative replication initiation protein Rep
ref|NP_877980.1 Staphylococcus aureus RefSeq   replication initiator protein
ref|YP_002790910.1 Staphylococcus aureus RefSeq   putative replication initiator protein Rep
ref|YP_492687.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   replication initiator protein
ref|ZP_05701250.1 Staphylococcus aureus A5948 RefSeq   replication initiator protein
tr|O87367 Staphylococcus aureus TrEMBL   Putative replication initiator protein Rep
tr|Q2FDD7 Staphylococcus aureus (strain USA300) TrEMBL   Replication initiator protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search