The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.803: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: Uncharacterized protein YtxJ
Translate Function Assignments



Context on contig NC_007793 from base 799947 to 811061 (11115 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
797 799947 800708 762 +       3: 2 1 4   Iron compound ABC uptake transporter ATP-binding protein locus|SAUSA300_0720, protein_id|YP_493423.1, gi|87160807, geneID|3913039
798 800827 801855 1029 + 118     2: 2 1   Iron compound ABC uptake transporter substrate-binding protein locus|SAUSA300_0721, protein_id|YP_493424.1, gi|87162442, geneID|3915038
799 802486 802172 315 - 316         FIG01108317: hypothetical protein  
800 803427 802504 924 - 17     2: 6 13   UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158) gene_name|murB, locus|SAUSA300_0722, protein_id|YP_493425.1, gi|87161900, geneID|3914411
801 804072 803554 519 - 126         FIG01108570: hypothetical protein locus|SAUSA300_0723, protein_id|YP_493426.1, gi|87162085, geneID|3914628
802 804192 805070 879 + 119         FIG01108064: hypothetical protein locus|SAUSA300_0724, protein_id|YP_493427.1, gi|87161351, geneID|3912868
803 805224 805544 321 + 153         Uncharacterized protein YtxJ locus|SAUSA300_0725, protein_id|YP_493428.1, gi|87160980, geneID|3913312
804 805969 807093 1125 + 424     4: 7 8 5 14   Glycerate kinase (EC 2.7.1.31) locus|SAUSA300_0726, protein_id|YP_493429.1, gi|87160263, geneID|3913665
805 808508 807282 1227 - 188     5: 9 3 10 11 12   Tripeptide aminopeptidase (EC 3.4.11.4) gene_name|pepT, locus|SAUSA300_0727, protein_id|YP_493430.1, gi|87160440, geneID|3912943
806 809016 808522 495 - 13         Integral membrane protein locus|SAUSA300_0728, protein_id|YP_493431.1, gi|87162233, geneID|3914858
807 809795 809034 762 - 17         FIG01108451: hypothetical protein locus|SAUSA300_0729, protein_id|YP_493432.1, gi|87160080, geneID|3913304
808 811061 809991 1071 - 195         GGDEF domain-containing protein locus|SAUSA300_0730, protein_id|YP_493433.1, gi|87161910, geneID|3913001

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|451515.3.peg.803 Uncharacterized protein YtxJ
MAIKLSSIDQFEQVIEENKYVFVLKHSETCPISANAYDQFNKFLYERDMDGYYLIVQQER
DLSDYIAKKTNVKHESPQAFYFVNGEMVWNRDHGDINVSSLAQAEE

MD5 = 6cf596a6621a8140f6d4d0b918c7a2ee


  DNA Sequence

>fig|451515.3.peg.803 Uncharacterized protein YtxJ
gtggctataaagctaagttcaattgaccaatttgaacaggttattgaggaaaataaatat
gtttttgtattaaaacatagtgaaacttgtccaatatcggcaaatgcgtacgatcaattt
aataaatttttatatgaacgcgatatggacggttattatttgattgtccaacaagaacgc
gatttgtcagattatattgctaaaaaaacgaacgttaaacatgaatcacctcaagcattt
tattttgtaaatggtgaaatggtttggaatcgagaccacggtgatatcaatgtgtcgtca
ttagcacaagcagaagaataa


  DNA with Flanking Sequence

>fig|451515.3.peg.803 Uncharacterized protein YtxJ
aacataataataaagcgttaagagatactgcgaagaagaacctagatgatagtaaagaaa
atgaagtaaaaggcgcgattaaaaatcacattatgccaatgattgaaaagcaaattaccg
atattaaccaaactaatattagtgataagcatgttaataatgcaaggaaaaacgcaatag
aaatgtattacagtctgcagaactattataatacacgtattgaaacaataaaggttagtg
agaagttatcaaaagtcgatgtagataagttgccgaaaaagggtatagatataactcacg
gcgataaagcctttgaaaaaaagcttgaaaaattagaagaaaaataactataatcatttt
tcaaagttaaaaattttgaatttatggttaacatgtcaacttactatgtgtataatggta
aacattgatattaactatatgtataaaaatgtcacgcagatgctatttaaatgtgataaa
tatttttagaggtgaatagagtggctataaagctaagttcaattgaccaatttgaacagg
ttattgaggaaaataaatatgtttttgtattaaaacatagtgaaacttgtccaatatcgg
caaatgcgtacgatcaatttaataaatttttatatgaacgcgatatggacggttattatt
tgattgtccaacaagaacgcgatttgtcagattatattgctaaaaaaacgaacgttaaac
atgaatcacctcaagcattttattttgtaaatggtgaaatggtttggaatcgagaccacg
gtgatatcaatgtgtcgtcattagcacaagcagaagaataatgaaactatagggttggaa
cattttgccttacactactagacgtgaatagcacaacttaaattcgtgtgaatcagagta
gtttggctataatgatgttctgaccttttattttatgtcacctttagaagcagttaagtt
agtacttttttacaaacatatgtataatatattcgagtatttttattgaaaatattttgg
aaaacgacgaatccaataagaaaatttaaacatgatttgtaagttagtttaataggaaat
atatgctaaaccaaaagaagcatattgttatttactggaataattaataatcatgtcatg
ttaaatgttcgcatataatcacgagataaaatctaaaatttaagattaatcttttatgaa
taaaaaacgtatcacaacaaataataaagtaaggtggtcaaggttatgaaagtattagta
gccatggatgagtttcatggaattatttcaagttatcaagctaatagatatgttgaagag
g


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01SA0748 Staphylococcus aureus N315     conserved hypothetical protein
cmr|NT02SA0742 Staphylococcus aureus Mu50     general stress protein BH3013
cmr|NT03SA0774 Staphylococcus aureus MW2     conserved hypothetical protein
cmr|NT05SA0677 Staphylococcus aureus NCTC 8325     YtxJ
cmr|NT08SA0779 Staphylococcus aureus subsp. aureus MRSA252     conserved hypothetical protein
cmr|NT09SA0715 Staphylococcus aureus subsp. aureus MSSA476     conserved hypothetical protein
cmr|NT11SA0706 Staphylococcus aureus RF122     YtxJ
cmr|SACOL0804 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_0725 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAB41929.1 Staphylococcus aureus subsp. aureus N315     conserved hypothetical protein
dbj|BAB56903.1 Staphylococcus aureus subsp. aureus Mu50     conserved hypothetical protein
dbj|BAB94568.1 Staphylococcus aureus subsp. aureus MW2     conserved hypothetical protein
dbj|BAF66982.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF77621.1 Staphylococcus aureus subsp. aureus Mu3     conserved hypothetical protein
emb|CAG39805.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   conserved hypothetical protein
emb|CAG42482.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   conserved hypothetical protein
emb|CAI80381.1 Staphylococcus aureus RF122 EMBL   conserved hypothetical protein
fig|158878.1.peg.741 Staphylococcus aureus subsp. aureus Mu50 FIG   Uncharacterized protein YtxJ
fig|158878.14.peg.758 Staphylococcus aureus subsp. aureus Mu50 FIG   Uncharacterized protein YtxJ
fig|158879.1.peg.712 Staphylococcus aureus subsp. aureus N315 FIG   Uncharacterized protein YtxJ
fig|158879.11.peg.735 Staphylococcus aureus subsp. aureus N315 FIG   Uncharacterized protein YtxJ
fig|196620.1.peg.703 Staphylococcus aureus subsp. aureus MW2 FIG   Uncharacterized protein YtxJ
fig|196620.5.peg.740 Staphylococcus aureus subsp. aureus MW2 FIG   Uncharacterized protein YtxJ
fig|273036.3.peg.772 Staphylococcus aureus RF122 FIG   Uncharacterized protein YtxJ
fig|273036.6.peg.742 Staphylococcus aureus RF122 FIG   Uncharacterized protein YtxJ
fig|282458.1.peg.741 Staphylococcus aureus subsp. aureus MRSA252 FIG   Uncharacterized protein YtxJ
fig|282458.4.peg.793 Staphylococcus aureus subsp. aureus MRSA252 FIG   Uncharacterized protein YtxJ
fig|282459.1.peg.701 Staphylococcus aureus subsp. aureus MSSA476 FIG   Uncharacterized protein YtxJ
fig|282459.5.peg.736 Staphylococcus aureus subsp. aureus MSSA476 FIG   Uncharacterized protein YtxJ
fig|359786.13.peg.827 Staphylococcus aureus subsp. aureus JH9 FIG   Uncharacterized protein YtxJ
fig|359786.3.peg.2541 Staphylococcus aureus subsp. aureus JH9 FIG   Uncharacterized protein YtxJ
fig|359787.3.peg.2374 Staphylococcus aureus subsp. aureus JH1 FIG   Uncharacterized protein YtxJ
fig|367830.3.peg.1846 Staphylococcus aureus subsp. aureus USA300 FIG   Uncharacterized protein YtxJ
fig|418127.4.peg.693 Staphylococcus aureus subsp. aureus Mu3 FIG   Uncharacterized protein YtxJ
fig|426430.6.peg.696 Staphylococcus aureus subsp. aureus str. Newman FIG   Uncharacterized protein YtxJ
fig|426430.8.peg.766 Staphylococcus aureus subsp. aureus str. Newman FIG   Uncharacterized protein YtxJ
fig|450394.6.peg.1304 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Uncharacterized protein YtxJ
fig|451516.9.peg.807 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Uncharacterized protein YtxJ
fig|452948.4.peg.1478 Staphylococcus aureus 930918-3 FIG   Uncharacterized protein YtxJ
fig|455227.3.peg.1561 Staphylococcus aureus D30 FIG   Uncharacterized protein YtxJ
fig|505321.3.peg.1336 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Uncharacterized protein YtxJ
fig|546342.3.peg.2448 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Uncharacterized protein YtxJ
fig|546343.3.peg.1266 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Uncharacterized protein YtxJ
fig|548470.3.peg.1743 Staphylococcus aureus subsp. aureus MN8 FIG   Uncharacterized protein YtxJ
fig|548473.3.peg.1182 Staphylococcus aureus subsp. aureus TCH60 FIG   Uncharacterized protein YtxJ
fig|548475.3.peg.1044 Staphylococcus aureus subsp. aureus TCH70 FIG   Uncharacterized protein YtxJ
fig|553565.3.peg.738 Staphylococcus aureus A5937 FIG   Uncharacterized protein YtxJ
fig|553567.3.peg.2451 Staphylococcus aureus A5948 FIG   Uncharacterized protein YtxJ
fig|553568.3.peg.1935 Staphylococcus aureus A6224 FIG   Uncharacterized protein YtxJ
fig|553571.3.peg.829 Staphylococcus aureus A6300 FIG   Uncharacterized protein YtxJ
fig|553573.3.peg.447 Staphylococcus aureus A8115 FIG   Uncharacterized protein YtxJ
fig|553577.3.peg.1262 Staphylococcus aureus A8796 FIG   Uncharacterized protein YtxJ
fig|553580.3.peg.1607 Staphylococcus aureus A8819 FIG   Uncharacterized protein YtxJ
fig|553581.3.peg.477 Staphylococcus aureus A9299 FIG   Uncharacterized protein YtxJ
fig|553583.3.peg.902 Staphylococcus aureus A9635 FIG   Uncharacterized protein YtxJ
fig|553588.3.peg.1877 Staphylococcus aureus A9719 FIG   Uncharacterized protein YtxJ
fig|553590.4.peg.2576 Staphylococcus aureus A9754 FIG   Uncharacterized protein YtxJ
fig|553592.3.peg.2587 Staphylococcus aureus A9763 FIG   Uncharacterized protein YtxJ
fig|553594.3.peg.1047 Staphylococcus aureus A9765 FIG   Uncharacterized protein YtxJ
fig|553601.3.peg.328 Staphylococcus aureus A10102 FIG   Uncharacterized protein YtxJ
fig|585143.3.peg.1262 Staphylococcus aureus subsp. aureus 55/2053 FIG   Uncharacterized protein YtxJ
fig|585144.3.peg.1619 Staphylococcus aureus subsp. aureus 58-424 FIG   Uncharacterized protein YtxJ
fig|585145.3.peg.1249 Staphylococcus aureus subsp. aureus 65-1322 FIG   Uncharacterized protein YtxJ
fig|585146.3.peg.1253 Staphylococcus aureus subsp. aureus 68-397 FIG   Uncharacterized protein YtxJ
fig|585147.3.peg.333 Staphylococcus aureus subsp. aureus A017934/97 FIG   Uncharacterized protein YtxJ
fig|585148.3.peg.302 Staphylococcus aureus subsp. aureus Btn1260 FIG   Uncharacterized protein YtxJ
fig|585149.6.peg.877 Staphylococcus aureus subsp. aureus C101 FIG   Uncharacterized protein YtxJ
fig|585150.3.peg.1328 Staphylococcus aureus subsp. aureus C160 FIG   Uncharacterized protein YtxJ
fig|585151.3.peg.365 Staphylococcus aureus subsp. aureus C427 FIG   Uncharacterized protein YtxJ
fig|585152.3.peg.675 Staphylococcus aureus subsp. aureus D139 FIG   Uncharacterized protein YtxJ
fig|585153.3.peg.1308 Staphylococcus aureus subsp. aureus E1410 FIG   Uncharacterized protein YtxJ
fig|585154.3.peg.740 Staphylococcus aureus subsp. aureus EMRSA16 FIG   Uncharacterized protein YtxJ
fig|585155.3.peg.1624 Staphylococcus aureus subsp. aureus H19 FIG   Uncharacterized protein YtxJ
fig|585156.3.peg.273 Staphylococcus aureus subsp. aureus M1015 FIG   Uncharacterized protein YtxJ
fig|585157.3.peg.435 Staphylococcus aureus subsp. aureus M809 FIG   Uncharacterized protein YtxJ
fig|585158.3.peg.1245 Staphylococcus aureus subsp. aureus M876 FIG   Uncharacterized protein YtxJ
fig|585891.3.peg.757 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Uncharacterized protein YtxJ
fig|644279.4.peg.829 Staphylococcus aureus subsp. aureus 132 FIG   Uncharacterized protein YtxJ
fig|680649.3.peg.481 Staphylococcus aureus subsp. aureus MR1 FIG   Uncharacterized protein YtxJ
fig|681288.4.peg.704 Staphylococcus aureus subsp. aureus ED98 FIG   Uncharacterized protein YtxJ
fig|703339.3.peg.731 Staphylococcus aureus 04-02981 FIG   Uncharacterized protein YtxJ
fig|762962.3.peg.1238 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Uncharacterized protein YtxJ
fig|93061.3.peg.728 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Uncharacterized protein YtxJ
fig|93061.5.peg.681 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Uncharacterized protein YtxJ
fig|93062.4.peg.290 Staphylococcus aureus subsp. aureus COL FIG   Uncharacterized protein YtxJ
gb|AAW37859.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD21468.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD29887.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ48568.1 Staphylococcus aureus subsp. aureus JH9     hypothetical protein SaurJH9_0765
gb|ABR51638.1 Staphylococcus aureus subsp. aureus JH1     conserved hypothetical protein
gb|ABX28789.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_0768
gb|EES55474.1 Staphylococcus aureus subsp. aureus TCH70     YtxJ like protein
gb|EES93623.1 Staphylococcus aureus subsp. aureus USA300_TCH959     YtxJ like protein
gb|EEV04554.1 Staphylococcus aureus subsp. aureus 55/2053     conserved hypothetical protein
gb|EEV07195.1 Staphylococcus aureus subsp. aureus 65-1322     conserved hypothetical protein
gb|EEV09958.1 Staphylococcus aureus subsp. aureus 68-397     conserved hypothetical protein
gb|EEV12411.1 Staphylococcus aureus subsp. aureus E1410     conserved hypothetical protein
gb|EEV15075.1 Staphylococcus aureus subsp. aureus M876     conserved hypothetical protein
gb|EEV27250.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV63526.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV66901.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV70474.1 Staphylococcus aureus A9635     conserved hypothetical protein
gb|EEV73388.1 Staphylococcus aureus A9299     conserved hypothetical protein
gb|EEV76158.1 Staphylococcus aureus A8115     conserved hypothetical protein
gb|EEV78311.1 Staphylococcus aureus A6300     conserved hypothetical protein
gb|EEV80015.1 Staphylococcus aureus A6224     conserved hypothetical protein
gb|EEV82314.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEV86629.1 Staphylococcus aureus A5937     conserved hypothetical protein
gb|EEW44804.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1049
gb|EEW46933.1 Staphylococcus aureus D30     hypothetical protein SAD30_0947
gi|13700632 Staphylococcus aureus subsp. aureus N315 NCBI   conserved hypothetical protein
gi|14246510 Staphylococcus aureus subsp. aureus Mu50 NCBI   conserved hypothetical protein
gi|147740270 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0765
gi|148267201 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0765
gi|149945702 Staphylococcus aureus subsp. aureus JH1 NCBI   conserved hypothetical protein
gi|150373722 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150393250 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_0782
gi|151220922 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0710
gi|156721204 Staphylococcus aureus subsp. aureus Mu3 NCBI   conserved hypothetical protein
gi|156979069 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0738
gi|15923731 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV0741
gi|15926418 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0696
gi|160367818 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0768
gi|161509009 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0768
gi|21203869 Staphylococcus aureus subsp. aureus MW2 NCBI   conserved hypothetical protein
gi|21282432 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW0703
gi|221139399 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_12240
gi|221141241 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_06323
gi|251802817 Staphylococcus aureus subsp. aureus TCH70 NCBI   YtxJ like protein
gi|251813711 Staphylococcus aureus subsp. aureus TCH70 NCBI   YtxJ like protein
gi|253315826 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_06705
gi|253724894 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   YtxJ like protein
gi|253731369 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   YtxJ like protein
gi|255005532 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_03655
gi|257272431 Staphylococcus aureus subsp. aureus 55/2053 NCBI   conserved hypothetical protein
gi|257275722 Staphylococcus aureus subsp. aureus 65-1322 NCBI   conserved hypothetical protein
gi|257279357 Staphylococcus aureus subsp. aureus 68-397 NCBI   conserved hypothetical protein
gi|257282276 Staphylococcus aureus subsp. aureus E1410 NCBI   conserved hypothetical protein
gi|257284956 Staphylococcus aureus subsp. aureus M876 NCBI   conserved hypothetical protein
gi|257424861 Staphylococcus aureus subsp. aureus 55/2053 NCBI   conserved hypothetical protein
gi|257427529 Staphylococcus aureus subsp. aureus 65-1322 NCBI   conserved hypothetical protein
gi|257430160 Staphylococcus aureus subsp. aureus 68-397 NCBI   conserved hypothetical protein
gi|257432861 Staphylococcus aureus subsp. aureus E1410 NCBI   conserved hypothetical protein
gi|257435765 Staphylococcus aureus subsp. aureus M876 NCBI   conserved hypothetical protein
gi|257788910 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257794938 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257839047 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257842477 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257846451 Staphylococcus aureus A9635 NCBI   conserved hypothetical protein
gi|257849418 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|257852231 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|257855373 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|257857116 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|257859460 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|257863873 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258418254 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258421551 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258423390 Staphylococcus aureus A9635 NCBI   conserved hypothetical protein
gi|258430746 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|258441762 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|258445797 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|258449608 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258452949 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258454008 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|259159763 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1049
gi|259162361 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0947
gi|49241127 Staphylococcus aureus subsp. aureus MRSA252 NCBI   conserved hypothetical protein
gi|49244056 Staphylococcus aureus subsp. aureus MSSA476 NCBI   conserved hypothetical protein
gi|49482998 Staphylococcus aureus subsp. aureus MRSA252 NCBI   hypothetical protein SAR0795
gi|49485613 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS0706
gi|57285765 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57651579 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0804
gi|82655976 Staphylococcus aureus RF122 NCBI   conserved hypothetical protein
gi|82750445 Staphylococcus aureus RF122 NCBI   hypothetical protein SAB0693
gi|87126954 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87160980 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_0725
gi|87202077 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194519 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00755
img|637092328 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637099255 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637151574 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637154243 Staphylococcus aureus aureus MRSA252 IMG   hypothetical protein
img|637156934 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637298463 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637815653 Staphylococcus aureus RF122 IMG   hypothetical protein
img|637887379 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637893404 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639108055 Staphylococcus aureus aureus JH1 IMG   conserved hypothetical protein
img|640565115 Staphylococcus aureus aureus JH9 IMG   hypothetical protein
img|640778867 Staphylococcus aureus aureus JH1 IMG   hypothetical protein
img|640795086 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640903477 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641308735 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
img|641773483 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_0725 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sab:SAB0693 Staphylococcus aureus RF122 KEGG   hypothetical protein
kegg|sac:SACOL0804 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_0710 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sah:SaurJH1_0782 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_0765 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sam:MW0703 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_00755 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sar:SAR0795   KEGG   hypothetical protein
kegg|sas:SAS0706   KEGG   hypothetical protein
kegg|sau:SA0696   KEGG   hypothetical protein
kegg|sav:SAV0741   KEGG   hypothetical protein
kegg|saw:SAHV_0738 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_0768 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|NP_371265.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV0741
ref|NP_373951.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0696
ref|NP_645520.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW0703
ref|YP_001246144.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_0765
ref|YP_001315925.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_0782
ref|YP_001331744.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0710
ref|YP_001441328.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0738
ref|YP_001574668.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_0768
ref|YP_040222.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   hypothetical protein SAR0795
ref|YP_042834.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS0706
ref|YP_185678.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0804
ref|YP_416186.1 Staphylococcus aureus RF122 RefSeq   hypothetical protein SAB0693
ref|YP_493428.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_0725
ref|YP_499314.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00755
ref|ZP_03564198.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_12240
ref|ZP_03565734.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_06323
ref|ZP_04828184.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   YtxJ like protein
ref|ZP_04839039.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_06705
ref|ZP_04865534.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   YtxJ like protein
ref|ZP_05144133.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_03655
ref|ZP_05601288.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   conserved hypothetical protein
ref|ZP_05603928.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   conserved hypothetical protein
ref|ZP_05606544.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   conserved hypothetical protein
ref|ZP_05609221.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   conserved hypothetical protein
ref|ZP_05611813.1 Staphylococcus aureus subsp. aureus M876 RefSeq   conserved hypothetical protein
ref|ZP_05643917.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05682519.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05684476.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05686281.1 Staphylococcus aureus A9635 RefSeq   conserved hypothetical protein
ref|ZP_05688458.1 Staphylococcus aureus A9299 RefSeq   conserved hypothetical protein
ref|ZP_05691034.1 Staphylococcus aureus A8115 RefSeq   conserved hypothetical protein
ref|ZP_05693974.1 Staphylococcus aureus A6300 RefSeq   conserved hypothetical protein
ref|ZP_05697710.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
ref|ZP_05700943.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
ref|ZP_05701980.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
tr|A5IQU5 Staphylococcus aureus (strain JH9) TrEMBL   Putative uncharacterized protein
tr|A6QF50 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A6TZM0 Staphylococcus aureus (strain JH1) TrEMBL   Putative uncharacterized protein
tr|A7WZN3 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|A8Z016 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|C5N3J2 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   YtxJ like protein
tr|C5QHB8 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   YtxJ like protein
tr|Q2FIQ0 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2G066 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q2YSI8 Staphylococcus aureus (strain bovine RF122 / ET3-1) TrEMBL   Putative uncharacterized protein
tr|Q5HHS9 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q6GB89 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative uncharacterized protein
tr|Q6GIQ0 Staphylococcus aureus (strain MRSA252) TrEMBL   Putative uncharacterized protein
tr|Q7A1H1 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW0703
tr|Q7A6S3 Staphylococcus aureus (strain N315) TrEMBL   Putative uncharacterized protein SA0696
tr|Q99VN3 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search