The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.8: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: Replication initiation protein, topisomerase
Translate Function Assignments



Context on contig NC_007791 from base 36 to 4313 (4278 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
6 36 1415 1380 +           Tetracycline resistence protein, metal-tetracycline/H+ antiporter locus|SAUSA300_pUSA020001, protein_id|YP_492684.1, gi|87159845, geneID|3912723
7 1601 2842 1242 + 185         Plasmid recombination, MobE mobilization protein locus|SAUSA300_pUSA020002, protein_id|YP_492685.1, gi|87159846, geneID|3912724
8 3564 4313 750 + 721     1: 1   Replication initiation protein, topisomerase locus|SAUSA300_pUSA020003, protein_id|YP_492686.1, gi|87159844, geneID|3912722

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Rolling-circle_replication VeronikaV Replication initiation protein, topisomerase


  Protein Sequence

>fig|451515.3.peg.8 Replication initiation protein, topisomerase
MSVEPQIRLWDILQTKFKAKALQEKVYIEYDKVKADSWDRRNMRIEFNPNKLTRDEMIWL
KQNIISYMEDDGFTRLDLAFDFEDDLSDYYAMSDKAVKKTIFYGRNGKPETKYFGVRDSN
RFIRIYNKKKERKDNADAEVMSEHLWRVEIELKRDMVDYWNDCFSDLHILQPDWKTIQRT
ADRAIVFMLLSDEEEWGKLHRNSRTKYKNLIKEISPVDLTDLMKSTLKANEKQLQKQIDF
WQHEFKFWK

MD5 = c0c8c3f133f3eac7e0fe27370684c881


  DNA Sequence

>fig|451515.3.peg.8 Replication initiation protein, topisomerase
atgagtgtagagccccaaataagactttgggatattcttcaaacaaagtttaaagctaaa
gcacttcaagaaaaagtttatattgaatatgacaaagtgaaagcagatagttgggataga
cgtaatatgcgtattgaatttaatccaaacaaacttacacgagatgaaatgatttggtta
aaacaaaatataataagctacatggaagatgacggttttacaagattagatttagccttt
gattttgaagatgatttgagtgactactatgcaatgtctgataaagcagttaagaaaact
attttttatggtcgtaatggtaagccagaaacaaaatattttggcgtgagagatagtaat
agatttattagaatttataataaaaagaaagaacgtaaagataatgcagatgctgaagtt
atgtctgaacatttatggcgtgtagaaatcgaacttaaaagagatatggtggattactgg
aatgattgctttagtgatttacatatcttgcaaccagattggaaaactatccaacgcact
gcggatagagcaatagtttttatgttattgagtgatgaagaagaatggggaaagcttcac
agaaattctagaacaaaatataagaatttgataaaagaaatttcgccagtcgatttaacg
gacttaatgaaatcgactttaaaagcgaacgaaaaacaattgcaaaaacaaatcgatttt
tggcaacatgaatttaaattttggaaatag


  DNA with Flanking Sequence

>fig|451515.3.peg.8 Replication initiation protein, topisomerase
agtaagtatgtacttggtgttttagtagttttaactgtttaccagataatacaaatgctt
aaataaaaaaagacttgatctgattagaccaagtcttttgatagtgttatattaataaca
aaataaaaaggagtcgctcacgccctgaccaaagtttgtgaacgacatcattcaaagaaa
aaaacactgagttatttttataatcttgtatatttagatattaaacgatatttaaatata
catcaagatatatatttgggtgagcgattccttaaacgaaattgagattaaggagtcgat
tttttatgtataaaaacaatcatgcaaatcattcaaatcatttggaaaatcacgatttag
acaatttttctaaaaccggctactctaatagccggttggacgcacatactgtgtgcatat
ctgatccaaaattaagttttgatgcaatgacgatcgttggaaatctcaaccgagacaacg
ctcaagccctttctaaatttatgagtgtagagccccaaataagactttgggatattcttc
aaacaaagtttaaagctaaagcacttcaagaaaaagtttatattgaatatgacaaagtga
aagcagatagttgggatagacgtaatatgcgtattgaatttaatccaaacaaacttacac
gagatgaaatgatttggttaaaacaaaatataataagctacatggaagatgacggtttta
caagattagatttagcctttgattttgaagatgatttgagtgactactatgcaatgtctg
ataaagcagttaagaaaactattttttatggtcgtaatggtaagccagaaacaaaatatt
ttggcgtgagagatagtaatagatttattagaatttataataaaaagaaagaacgtaaag
ataatgcagatgctgaagttatgtctgaacatttatggcgtgtagaaatcgaacttaaaa
gagatatggtggattactggaatgattgctttagtgatttacatatcttgcaaccagatt
ggaaaactatccaacgcactgcggatagagcaatagtttttatgttattgagtgatgaag
aagaatggggaaagcttcacagaaattctagaacaaaatataagaatttgataaaagaaa
tttcgccagtcgatttaacggacttaatgaaatcgactttaaaagcgaacgaaaaacaat
tgcaaaaacaaatcgatttttggcaacatgaatttaaattttggaaatagtgtacatatt
aatattactgaacaaaaatgatatatttaaactattctaatttaggaggatttttttatg
aagtgtctatttaaaaatttggggaatttatatgaggtgaaagaataatttacccc


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search