The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.748: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: FIG01108122: hypothetical protein
Translate Function Assignments



Context on contig NC_007793 from base 742895 to 754208 (11314 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
744 742895 744526 1632 +       3: 3 2 1   Transport ATP-binding protein CydD locus|SAUSA300_0670, protein_id|YP_493373.1, gi|87160765, geneID|3913740
745 744523 746196 1674 + -4     3: 3 2 1   Transport ATP-binding protein CydC locus|SAUSA300_0671, protein_id|YP_493374.1, gi|87161470, geneID|3914061
746 746766 746323 444 - 126       dlit(15292128)
dlit(12730173)
dlit(15774883)
dlit(15731040)
dlit(12813062)
Transcriptional regulator MgrA (Regulator of autolytic activity) locus|SAUSA300_0672, protein_id|YP_493375.1, gi|87159899, geneID|3914945
747 746993 747919 927 + 226     2: 9 6   Putative metal chaperone, involved in Zn homeostasis, GTPase of COG0523 family locus|SAUSA300_0673, protein_id|YP_493376.1, gi|87160770, geneID|3913745
748 748022 748930 909 + 102         FIG01108122: hypothetical protein locus|SAUSA300_0674, protein_id|YP_493377.1, gi|87161787, geneID|3914030
749 748965 749252 288 + 34         FIG01107862: hypothetical protein locus|SAUSA300_0675, protein_id|YP_493378.1, gi|87161921, geneID|3914581
750 749535 751088 1554 + 282         Sodium/di- and tricarboxylate cotransporter locus|SAUSA300_0676, protein_id|YP_493379.1, gi|87160917, geneID|3914355
751 751174 752547 1374 + 85     4: 7 8 4 5   Deoxyribodipyrimidine photolyase (EC 4.1.99.3) locus|SAUSA300_0677, protein_id|YP_493380.1, gi|87161809, geneID|3914645
752 753049 752702 348 - 154         FIG01108118: hypothetical protein  
753 753600 752983 618 - -67         FIG01108543: hypothetical protein locus|SAUSA300_0678, protein_id|YP_493381.1, gi|87161469, geneID|3914060
754 754208 753786 423 - 185         FIG01108024: hypothetical protein locus|SAUSA300_0679, protein_id|YP_493382.1, gi|87162052, geneID|3914328

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|451515.3.peg.748 FIG01108122: hypothetical protein
MEQIMINHYVHFSRLVQGFWRANEWKMTAKELNYFINELVERGITTMDHADIYGDYQCES
LFGNALDLSPELRNKIQIVTKCGIILPSKQFDFTNGHRYDLSSKHIVKSVEQSLINLNVD
YLDSLLIHRPSPLMDPEQVADALTKLVKQGKLKSFGVSNFNHSQYQLLNQYIMKERLHIS
INQLELSPYHVDSLQDGTMDSMYQNHVQIMAWSPFAGGKIFDKEDIKAQRIMKVVQSIAD
KYGVSDTAVMIAWLVKIPHRIMPILGTSQLKRIDQAIEGLQLNLDDQSWFDIYTAIIVQD
IP

MD5 = 9402e669eba4e8eb5066b843f401ab56


  DNA Sequence

>fig|451515.3.peg.748 FIG01108122: hypothetical protein
atggaacaaataatgattaatcactatgttcatttttctaggcttgtacaaggtttttgg
cgtgcaaatgaatggaagatgactgcgaaagagttaaattattttataaatgaattagtt
gaacgtggaattacaacgatggatcatgctgatatttatggagattatcaatgtgaatca
ctgtttggtaatgctttggatttatcacccgaattaagaaataaaattcaaattgttacg
aaatgtggtatcattttgccttctaagcaatttgattttacaaatggacatcgttatgat
ttgagtagtaagcacatcgtgaaatctgttgaacagtcattaatcaatttgaatgtagat
tatttagatagtctactcattcatcgtccttcaccattgatggatccagaacaagttgct
gatgcattaactaaacttgttaaacaaggtaagttgaagtcattcggggtgtcgaatttt
aatcattcacaataccaattgttaaatcaatatattatgaaagaaagactacatattagc
atcaatcaattagaattatcgccatatcacgttgatagtttacaagatggaacaatggat
tcaatgtatcaaaaccatgttcaaatcatggcttggagtccttttgcaggcggtaaaatt
ttcgacaaggaagatattaaagcgcaacgtattatgaaagttgttcaatcaatagctgac
aaatatggtgtgagtgacacagctgtgatgatagcgtggttagtaaaaataccgcatcgt
atcatgccgatacttggaacaagtcagttaaagcgtattgatcaagcaatcgaagggcta
caacttaatttagatgatcagtcgtggtttgacatttacaccgctattatcgtacaagat
attccgtaa


  DNA with Flanking Sequence

>fig|451515.3.peg.748 FIG01108122: hypothetical protein
agcaattaggtatgatttgtgcaagtattccaacttataaaacaacctatggaaaagttt
cgttggaagaattggacttaactgttaaagacagagagatatcgtctcatcatcaccatc
atcatgggattaaaagtatgacttacacgtttacaggtccgattgatcgtcatttgtttt
atcaatttataatgaaattaccggaatctgttctacgtttgaaaggttatgtgtcattta
gagatcaaccaaatgcaatttatgaatttcaatatgcatatggtttaccagactatggaa
taattggcatgcaattaccattaacgattgttattattggtgaaactttagatacaaatc
acatacgtaatcaattggatatgctacaatttacgtaaatcagaaaatgtgttgtttcaa
tttaacggaaatagcacattaatttcttaatacttttattgtgaatattttgtgacattg
agggatggagtggatgagatatggaacaaataatgattaatcactatgttcatttttcta
ggcttgtacaaggtttttggcgtgcaaatgaatggaagatgactgcgaaagagttaaatt
attttataaatgaattagttgaacgtggaattacaacgatggatcatgctgatatttatg
gagattatcaatgtgaatcactgtttggtaatgctttggatttatcacccgaattaagaa
ataaaattcaaattgttacgaaatgtggtatcattttgccttctaagcaatttgatttta
caaatggacatcgttatgatttgagtagtaagcacatcgtgaaatctgttgaacagtcat
taatcaatttgaatgtagattatttagatagtctactcattcatcgtccttcaccattga
tggatccagaacaagttgctgatgcattaactaaacttgttaaacaaggtaagttgaagt
cattcggggtgtcgaattttaatcattcacaataccaattgttaaatcaatatattatga
aagaaagactacatattagcatcaatcaattagaattatcgccatatcacgttgatagtt
tacaagatggaacaatggattcaatgtatcaaaaccatgttcaaatcatggcttggagtc
cttttgcaggcggtaaaattttcgacaaggaagatattaaagcgcaacgtattatgaaag
ttgttcaatcaatagctgacaaatatggtgtgagtgacacagctgtgatgatagcgtggt
tagtaaaaataccgcatcgtatcatgccgatacttggaacaagtcagttaaagcgtattg
atcaagcaatcgaagggctacaacttaatttagatgatcagtcgtggtttgacatttaca
ccgctattatcgtacaagatattccgtaaacttatttacttttaaatcataaaggagcat
atcatgacaaacgaagataaacgtttcgaacaattaagatttgaacgcaaatttatagtt
attccgtatttaatttatgcagtcattgtattactattaaatattttctattctgatttg
aaaataacaatgacattattcggacttttctttgcgtataatgtagtcattttgttcata
gcatttgttaaacattataaacgcacattgttactaagtcttatattaacagtgcttagt
ggcgcggcattctttggaattatttatgtttatggcattaatcatttttaaacattaaaa
agagactatctacaataatctcatttgcattttatctaactaagtttaacttttgcttag
aaaaatgatgctatgaggatattcagtagatagtttttttatgatctaatatttaaactt
agatatcgttttgtaattaaccgagataactcatcacctagcaatatta


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0016491       F:oxidoreductase activity
GO:0055114       P:oxidation reduction
cmr|SAUSA300_0674 Staphylococcus aureus subsp. aureus USA300-FPR3757     oxidoreductase, aldo/keto reductase family
fig|367830.3.peg.1307 Staphylococcus aureus subsp. aureus USA300 FIG   FIG01108122: hypothetical protein
fig|451516.9.peg.752 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   FIG01108122: hypothetical protein
fig|553590.4.peg.1426 Staphylococcus aureus A9754 FIG   FIG01108122: hypothetical protein
gb|ABD22275.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     oxidoreductase, aldo/keto reductase family
gb|ABX28732.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     possible aldo/keto reductase
gi|160367761 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   possible aldo/keto reductase
gi|161508952 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   aldo/keto reductase
gi|87127761 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   oxidoreductase, aldo/keto reductase family
gi|87161787 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   aldo/keto reductase family oxidoreductase
img|637887328 Staphylococcus aureus aureus USA300 IMG   oxidoreductase, aldo/keto reductase family( EC:1.- )
img|641308678 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   possible aldo/keto reductase
kegg|saa:SAUSA300_0674 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   aldo/keto reductase family oxidoreductase (EC:1.-.-.-)
kegg|sax:USA300HOU_0711 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   aldo/keto reductase
ref|YP_001574611.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   aldo/keto reductase
ref|YP_493377.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   aldo/keto reductase family oxidoreductase
tr|A8YZV9 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Possible aldo/keto reductase
tr|Q2FIV1 Staphylococcus aureus (strain USA300) TrEMBL   Oxidoreductase, aldo/keto reductase family


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search