The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
 The SEED


FIG search

Protein fig|451515.3.peg.587: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: LSU ribosomal protein L7p/L12p (P1/P2)
Translate Function Assignments


Context on contig NC_007793 from base 578893 to 592865 (13973 bp)

Fid Start End Size
(nt)		   Gap Find
best
clusters		 Pins Fc-sc SS Ev Function Aliases
578 578893 579639 747 +           23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-) ## LSU rRNA Gm2251 locus|SAUSA300_0517, protein_id|YP_493220.1, gi|87162210, geneID|3914853
579 579639 580163 525 + -1         Hypothetical protein DUF901, similar to C-terminal domain of ribosome protection-type Tc-resistance proteins locus|SAUSA300_0518, protein_id|YP_493221.1, gi|87160481, geneID|3913336
580 580244 580813 570 + 80     2: 9 11   RNA polymerase sporulation specific sigma factor SigH locus|SAUSA300_0519, protein_id|YP_493222.1, gi|87161083, geneID|3914269
581 580928 581071 144 + 114 7 3: 3 2 8   LSU ribosomal protein L33p @ LSU ribosomal protein L33p, zinc-dependent  
582 581127 581309 183 + 55     1: 1   Preprotein translocase subunit SecE (TC 3.A.5.1.1) gene_name|secE, locus|SAUSA300_0520, protein_id|YP_493223.1, gi|87161634, geneID|3913684
583 581322 581870 549 + 12 71 2: 10 1   Transcription antitermination protein NusG gene_name|nusG, locus|SAUSA300_0521, protein_id|YP_493224.1, gi|87160422, geneID|3913140
584 582051 582473 423 + 180 43 5: 4 3 2 5 1   LSU ribosomal protein L11p (L12e) gene_name|rplK, locus|SAUSA300_0522, protein_id|YP_493225.1, gi|87161133, geneID|3913722
585 582681 583373 693 + 207 64 6: 4 3 2 7 5 1   LSU ribosomal protein L1p (L10Ae) gene_name|rplA, locus|SAUSA300_0523, protein_id|YP_493226.1, gi|87162295, geneID|3913604
586 583645 584145 501 + 271 73 4: 4 3 2 1   LSU ribosomal protein L10p (P0) gene_name|rplJ, locus|SAUSA300_0524, protein_id|YP_493227.1, gi|87160740, geneID|3913441
587 584188 584556 369 + 42   5: 4 3 2 5 1   LSU ribosomal protein L7p/L12p (P1/P2) gene_name|rplL, locus|SAUSA300_0525, protein_id|YP_493228.1, gi|87161455, geneID|3914128
588 584731 585339 609 + 174         16S rRNA (guanine(1207)-N(2))-methyltransferase (EC 2.1.1.172) ## RsmC locus|SAUSA300_0526, protein_id|YP_493229.1, gi|87161944, geneID|3913701
589 585554 589105 3552 + 214 20 2: 6 7   DNA-directed RNA polymerase beta subunit (EC 2.7.7.6) gene_name|rpoB, locus|SAUSA300_0527, protein_id|YP_493230.2, gi|162138570, geneID|3914836
590 589242 592865 3624 + 136 14 1: 6   DNA-directed RNA polymerase beta' subunit (EC 2.7.7.6) gene_name|rpoC, locus|SAUSA300_0528, protein_id|YP_493231.1, gi|87161137, geneID|3913726

Annotation History   /   View All Related Annotations Help on Annotations


  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Ribospme_LSU_Symbiont vcrecy LSU ribosomal protein L7/L12 (P1/P2)
LSU_ribosomal_proteins_cluster LSU ribosomal protein L7/L12 (P1/P2)
Ribosome_LSU_bacterial gjo LSU ribosomal protein L7/L12 (P1/P2)
Single-copy_ribosomal_proteins gjo LSU ribosomal protein L7/L12 (P1/P2)
PanGenomes_ForPhylogeny_Str Ravcheev_Dmitry_user LSU ribosomal protein L7p/L12p (P1/P2)


  Protein Sequence

>fig|451515.3.peg.587 LSU ribosomal protein L7p/L12p (P1/P2)
MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVEL
TSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVE
LK

MD5 = 0aab7862082de4b1aa6496ac2d07f72e


  DNA Sequence

>fig|451515.3.peg.587 LSU ribosomal protein L7p/L12p (P1/P2)
atggctaatcatgaacaaatcattgaagcgattaaagaaatgtcagtattagaattaaac
gacttagtaaaagcaattgaagaagaatttggtgtaactgcagctgctccagtagcagta
gcaggtgcagctggtggcgctgacgctgcagcagaaaaaactgaatttgacgttgagtta
acttcagctggttcatctaaaatcaaagttgttaaagctgttaaagaagcaactggttta
ggattaaaagatgctaaagaattagtagacggagctcctaaagtaatcaaagaagcttta
cctaaagaagaagctgaaaaacttaaagaacaattagaagaagttggagctactgtagaa
ttaaaataa


  DNA with Flanking Sequence

>fig|451515.3.peg.587 LSU ribosomal protein L7p/L12p (P1/P2)
ttgctgaggtactatcaaattcagtttcaacagtaatcgttgactaccgtggattaacag
tagctgaagttactgacttacgttcacaattacgtgaagctggtgttgagtataaagtat
acaaaaacactatggtacgtcgtgcagctgaaaaagctggtatcgaaggcttagatgaat
tcttaacaggtcctactgctattgcaacttcaagtgaagatgctgtagctgcagcgaaag
taatttctggatttgctaaagatcatgaagcattagaaattaaatcaggcgttatggaag
gcaatgttattacagcagaagaagttaaaactgttggttcattaccttcacacgatggtc
ttgtatctatgcttttatcagtattacaagctcctgtacgcaacttcgcttatgcggtta
aagctattggagaacaaaaagaagaaaacgctgaataatttttagcgtaaaaaaattaaa
aataatggaggaattataaaatggctaatcatgaacaaatcattgaagcgattaaagaaa
tgtcagtattagaattaaacgacttagtaaaagcaattgaagaagaatttggtgtaactg
cagctgctccagtagcagtagcaggtgcagctggtggcgctgacgctgcagcagaaaaaa
ctgaatttgacgttgagttaacttcagctggttcatctaaaatcaaagttgttaaagctg
ttaaagaagcaactggtttaggattaaaagatgctaaagaattagtagacggagctccta
aagtaatcaaagaagctttacctaaagaagaagctgaaaaacttaaagaacaattagaag
aagttggagctactgtagaattaaaataattcaagtatcttaaacttaataatcaaagtt
ttatagcaagtattgctataatataatgattctttgagaagttaaaaccccgttattttg
ataacggggttttattcatttaaagactgagtgaaatgttataattataatgacgagtta
caaagtgaagatgaggtggaataatgagtcattattacgatgaagatccaagtgtaatta
gcaatgaacaacgtattcaatatcaattaaaccatcataaaattgatttaataactgata
acggagtgttttcgaaagataaagtagattatggttcagatgttcttgttcaaacttttt
taaaagcgcatccacctggtccaagtaagcgaattgccgatgttggttgtggttacggac
caattggtttgatgattgctaaagtatcaccacatcattcaattacaatgctagatgtta
atcacagagcgctagccttagttgaaaaaaacaaaaaattaaatggtat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003735       F:structural constituent of ribosome
GO:0005840       C:ribosome
GO:0006412       P:translation
cmr|NT01SA0542 Staphylococcus aureus N315     ribosomal protein L7/L12
cmr|NT02SA0546 Staphylococcus aureus Mu50     ribosomal protein L7/L12
cmr|NT03SA0553 Staphylococcus aureus MW2     ribosomal protein L7/L12
cmr|NT05SA0472 Staphylococcus aureus NCTC 8325     ribosomal protein L7/L12
cmr|NT09SA0511 Staphylococcus aureus subsp. aureus MSSA476     ribosomal protein L7/L12
cmr|SACOL0586 Staphylococcus aureus subsp. aureus COL     ribosomal protein L7/L12
cmr|SAUSA300_0525 Staphylococcus aureus subsp. aureus USA300-FPR3757     ribosomal protein L7/L12
dbj|BAB41729.1 Staphylococcus aureus subsp. aureus N315     50S ribosomal protein L7/L12
dbj|BAB56702.1 Staphylococcus aureus subsp. aureus Mu50     50S ribosomal protein L7/L12
dbj|BAB94360.1 Staphylococcus aureus subsp. aureus MW2     50S ribosomal protein L7/L12
dbj|BAF77421.1 Staphylococcus aureus subsp. aureus Mu3     50S ribosomal protein L7/L12
emb|CAG42273.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   50S ribosomal protein L7/L12
fig|158878.1.peg.540 Staphylococcus aureus subsp. aureus Mu50 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|158878.14.peg.546 Staphylococcus aureus subsp. aureus Mu50 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|158879.1.peg.512 Staphylococcus aureus subsp. aureus N315 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|158879.11.peg.524 Staphylococcus aureus subsp. aureus N315 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|196620.1.peg.495 Staphylococcus aureus subsp. aureus MW2 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|196620.5.peg.524 Staphylococcus aureus subsp. aureus MW2 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|282459.1.peg.493 Staphylococcus aureus subsp. aureus MSSA476 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|282459.5.peg.520 Staphylococcus aureus subsp. aureus MSSA476 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|359786.13.peg.615 Staphylococcus aureus subsp. aureus JH9 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|359786.3.peg.484 Staphylococcus aureus subsp. aureus JH9 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|359787.11.peg.605 Staphylococcus aureus subsp. aureus JH1 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|359787.3.peg.401 Staphylococcus aureus subsp. aureus JH1 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|367830.3.peg.456 Staphylococcus aureus subsp. aureus USA300 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|418127.4.peg.506 Staphylococcus aureus subsp. aureus Mu3 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|418127.6.peg.543 Staphylococcus aureus subsp. aureus Mu3 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|450394.6.peg.445 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|451516.9.peg.577 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|452948.4.peg.1603 Staphylococcus aureus 930918-3 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|455227.3.peg.1616 Staphylococcus aureus D30 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|505321.3.peg.1155 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|546342.3.peg.2668 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|546343.3.peg.1045 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|548474.3.peg.2106 Staphylococcus aureus subsp. aureus TCH130 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|548475.3.peg.24 Staphylococcus aureus subsp. aureus TCH70 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|553565.3.peg.515 Staphylococcus aureus A5937 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|553567.3.peg.2224 Staphylococcus aureus A5948 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|553568.3.peg.748 Staphylococcus aureus A6224 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|553571.3.peg.1367 Staphylococcus aureus A6300 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|553573.3.peg.1886 Staphylococcus aureus A8115 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|553574.3.peg.2285 Staphylococcus aureus A8117 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|553577.3.peg.2310 Staphylococcus aureus A8796 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|553580.3.peg.2060 Staphylococcus aureus A8819 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|553581.3.peg.2360 Staphylococcus aureus A9299 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|553583.3.peg.125 Staphylococcus aureus A9635 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|553588.3.peg.735 Staphylococcus aureus A9719 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|553590.4.peg.2365 Staphylococcus aureus A9754 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|553592.3.peg.1255 Staphylococcus aureus A9763 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|553594.3.peg.1859 Staphylococcus aureus A9765 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|553596.3.peg.2287 Staphylococcus aureus A9781 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|553601.3.peg.2269 Staphylococcus aureus A10102 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|585152.3.peg.457 Staphylococcus aureus subsp. aureus D139 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|585155.3.peg.1083 Staphylococcus aureus subsp. aureus H19 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|585891.3.peg.545 Staphylococcus aureus subsp. aureus Mu50-omega FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|644279.4.peg.612 Staphylococcus aureus subsp. aureus 132 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|680649.3.peg.1135 Staphylococcus aureus subsp. aureus MR1 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|681288.4.peg.493 Staphylococcus aureus subsp. aureus ED98 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|703339.3.peg.521 Staphylococcus aureus 04-02981 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|762962.3.peg.154 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|93061.3.peg.507 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|93061.5.peg.468 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|93062.19.peg.570 Staphylococcus aureus subsp. aureus COL FIG   LSU ribosomal protein L7p/L12p (P1/P2)
fig|93062.4.peg.1039 Staphylococcus aureus subsp. aureus COL FIG   LSU ribosomal protein L7p/L12p (P1/P2)
gb|AAW37696.1 Staphylococcus aureus subsp. aureus COL     ribosomal protein L7/L12
gb|ABD21943.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     ribosomal protein L7/L12
gb|ABD29670.1 Staphylococcus aureus subsp. aureus NCTC 8325     ribosomal protein L7/L12
gb|ABQ48367.1 Staphylococcus aureus subsp. aureus JH9     LSU ribosomal protein L12P
gb|ABR51435.1 Staphylococcus aureus subsp. aureus JH1     ribosomal protein L7/L12
gb|ABX28560.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     ribosomal protein L7/L12
gb|EES55648.1 Staphylococcus aureus subsp. aureus TCH70     50S ribosomal protein L7/L12
gb|EES93839.1 Staphylococcus aureus subsp. aureus USA300_TCH959     50S ribosomal protein L7/L12
gb|EES98206.1 Staphylococcus aureus subsp. aureus TCH130     50S ribosomal protein L7/L12
gb|EEV27673.1 Staphylococcus aureus A9781     50S ribosomal protein L7/L12
gb|EEV64766.1 Staphylococcus aureus A9763     50S ribosomal protein L12
gb|EEV68006.1 Staphylococcus aureus A9719     LSU ribosomal protein L7/L12
gb|EEV71193.1 Staphylococcus aureus A9635     LSU ribosomal protein L7/L12
gb|EEV71667.1 Staphylococcus aureus A9299     ribosomal protein L7/L12
gb|EEV74686.1 Staphylococcus aureus A8115     ribosomal protein L7/L12
gb|EEV77878.1 Staphylococcus aureus A6300     50S ribosomal protein L7/L12
gb|EEV81188.1 Staphylococcus aureus A6224     ribosomal protein L7/L12
gb|EEV82450.1 Staphylococcus aureus A5948     LSU ribosomal protein L12P
gb|EEV86798.1 Staphylococcus aureus A5937     50S ribosomal protein L7/L12
gb|EEW44718.1 Staphylococcus aureus 930918-3     50S ribosomal protein L7/L12
gb|EEW46896.1 Staphylococcus aureus D30     50S ribosomal protein L7/L12
gi|109893804 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L7/L12
gi|109940147 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L7/L12
gi|13700431 Staphylococcus aureus subsp. aureus N315 NCBI   50S ribosomal protein L7/L12
gi|14246308 Staphylococcus aureus subsp. aureus Mu50 NCBI   50S ribosomal protein L7/L12
gi|147740069 Staphylococcus aureus subsp. aureus JH9 NCBI   LSU ribosomal protein L12P
gi|148267000 Staphylococcus aureus subsp. aureus JH9 NCBI   50S ribosomal protein L7/L12
gi|149945499 Staphylococcus aureus subsp. aureus JH1 NCBI   ribosomal protein L7/L12
gi|150393047 Staphylococcus aureus subsp. aureus JH1 NCBI   50S ribosomal protein L7/L12
gi|156721004 Staphylococcus aureus subsp. aureus Mu3 NCBI   50S ribosomal protein L7/L12
gi|156978869 Staphylococcus aureus subsp. aureus Mu3 NCBI   50S ribosomal protein L7/L12
gi|15923530 Staphylococcus aureus subsp. aureus Mu50 NCBI   50S ribosomal protein L7/L12
gi|15926218 Staphylococcus aureus subsp. aureus N315 NCBI   50S ribosomal protein L7/L12
gi|160367589 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   ribosomal protein L7/L12
gi|161508780 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   50S ribosomal protein L7/L12
gi|166222215 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L7/L12
gi|189043013 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L7/L12
gi|189043014 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L7/L12
gi|189043015 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L7/L12
gi|21203660 Staphylococcus aureus subsp. aureus MW2 NCBI   50S ribosomal protein L7/L12
gi|21282224 Staphylococcus aureus subsp. aureus MW2 NCBI   50S ribosomal protein L7/L12
gi|221139613 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   50S ribosomal protein L7/L12
gi|221141023 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   50S ribosomal protein L7/L12
gi|251802991 Staphylococcus aureus subsp. aureus TCH70 NCBI   50S ribosomal protein L7/L12
gi|251813489 Staphylococcus aureus subsp. aureus TCH70 NCBI   50S ribosomal protein L7/L12
gi|253315650 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   50S ribosomal protein L7/L12
gi|253725110 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   50S ribosomal protein L7/L12
gi|253729477 Staphylococcus aureus subsp. aureus TCH130 NCBI   50S ribosomal protein L7/L12
gi|253731145 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   50S ribosomal protein L7/L12
gi|253732548 Staphylococcus aureus subsp. aureus TCH130 NCBI   50S ribosomal protein L7/L12
gi|255005334 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   50S ribosomal protein L7/L12
gi|257789333 Staphylococcus aureus A9781 NCBI   50S ribosomal protein L7/L12
gi|257795361 Staphylococcus aureus A9781 NCBI   50S ribosomal protein L7/L12
gi|257840303 Staphylococcus aureus A9763 NCBI   50S ribosomal protein L12
gi|257843600 Staphylococcus aureus A9719 NCBI   LSU ribosomal protein L7/L12
gi|257847185 Staphylococcus aureus A9635 NCBI   LSU ribosomal protein L7/L12
gi|257847668 Staphylococcus aureus A9299 NCBI   ribosomal protein L7/L12
gi|257850741 Staphylococcus aureus A8115 NCBI   ribosomal protein L7/L12
gi|257854933 Staphylococcus aureus A6300 NCBI   50S ribosomal protein L7/L12
gi|257858301 Staphylococcus aureus A6224 NCBI   ribosomal protein L7/L12
gi|257859600 Staphylococcus aureus A5948 NCBI   LSU ribosomal protein L12P
gi|257864044 Staphylococcus aureus A5937 NCBI   50S ribosomal protein L7/L12
gi|258408952 Staphylococcus aureus A9763 NCBI   50S ribosomal protein L12
gi|258420410 Staphylococcus aureus A9719 NCBI   LSU ribosomal protein L7/L12
gi|258422613 Staphylococcus aureus A9635 NCBI   LSU ribosomal protein L7/L12
gi|258439331 Staphylococcus aureus A9299 NCBI   ribosomal protein L7/L12
gi|258444071 Staphylococcus aureus A8115 NCBI   ribosomal protein L7/L12
gi|258446339 Staphylococcus aureus A6300 NCBI   50S ribosomal protein L7/L12
gi|258448432 Staphylococcus aureus A6224 NCBI   ribosomal protein L7/L12
gi|258452727 Staphylococcus aureus A5948 NCBI   LSU ribosomal protein L12P
gi|258453788 Staphylococcus aureus A5937 NCBI   50S ribosomal protein L7/L12
gi|259159674 Staphylococcus aureus 930918-3 NCBI   50S ribosomal protein L7/L12
gi|259162323 Staphylococcus aureus D30 NCBI   50S ribosomal protein L7/L12
gi|49243848 Staphylococcus aureus subsp. aureus MSSA476 NCBI   50S ribosomal protein L7/L12
gi|49485405 Staphylococcus aureus subsp. aureus MSSA476 NCBI   50S ribosomal protein L7/L12
gi|54039229 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L7/L12
gi|54039238 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L7/L12
gi|54041599 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L7/L12
gi|56749394 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L7/L12
gi|57285602 Staphylococcus aureus subsp. aureus COL NCBI   ribosomal protein L7/L12
gi|57651416 Staphylococcus aureus subsp. aureus COL NCBI   50S ribosomal protein L7/L12
gi|81695153 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L7/L12
gi|87127429 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   ribosomal protein L7/L12
gi|87161455 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   50S ribosomal protein L7/L12
gi|87201860 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   ribosomal protein L7/L12
gi|88194302 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   50S ribosomal protein L7/L12
img|637092128 Staphylococcus aureus aureus N315 IMG   50S ribosomal protein L7/L12
img|637099055 Staphylococcus aureus aureus Mu50 IMG   50S ribosomal protein L7/L12
img|637151368 Staphylococcus aureus aureus COL IMG   50S ribosomal protein L7/L12
img|637156726 Staphylococcus aureus aureus MSSA476 IMG   50S ribosomal protein L7/L12
img|637298255 Staphylococcus aureus aureus MW2 IMG   50S ribosomal protein L7/L12
img|637887179 Staphylococcus aureus aureus USA300 IMG   ribosomal protein L7/L12
img|637893184 Staphylococcus aureus aureus NCTC 8325 IMG   ribosomal protein L7/L12
img|639109665 Staphylococcus aureus aureus JH1 IMG   Ribosomal protein L7/L12
img|640564914 Staphylococcus aureus aureus JH9 IMG   ribosomal protein L7/L12
img|640778664 Staphylococcus aureus aureus JH1 IMG   ribosomal protein L7/L12
img|640903277 Staphylococcus aureus aureus Mu3 IMG   50S ribosomal protein L7/L12
img|641308506 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   ribosomal protein L7/L12
img|641772879 Staphylococcus aureus aureus USA300_TCH959 IMG   ribosomal protein L7/L12
kegg|saa:SAUSA300_0525 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   50S ribosomal protein L7/L12
kegg|sac:SACOL0586 Staphylococcus aureus subsp. aureus COL KEGG   50S ribosomal protein L7/L12
kegg|sah:SaurJH1_0577 Staphylococcus aureus subsp. aureus JH1 KEGG   50S ribosomal protein L7/L12
kegg|saj:SaurJH9_0563 Staphylococcus aureus subsp. aureus JH9 KEGG   50S ribosomal protein L7/L12
kegg|sam:MW0495 Staphylococcus aureus subsp. aureus MW2 KEGG   50S ribosomal protein L7/L12
kegg|sao:SAOUHSC_00521 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   50S ribosomal protein L7/L12
kegg|sas:SAS0498   KEGG   50S ribosomal protein L7/L12
kegg|sau:SA0498   KEGG   50S ribosomal protein L7/L12
kegg|sav:SAV0540   KEGG   50S ribosomal protein L7/L12
kegg|saw:SAHV_0538 Staphylococcus aureus subsp. aureus Mu3 KEGG   50S ribosomal protein L7/L12
kegg|sax:USA300HOU_0534 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   50S ribosomal protein L7/L12
ref|NP_371064.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   50S ribosomal protein L7/L12
ref|NP_373751.1 Staphylococcus aureus subsp. aureus N315 RefSeq   50S ribosomal protein L7/L12
ref|NP_645312.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   50S ribosomal protein L7/L12
ref|YP_001245943.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   50S ribosomal protein L7/L12
ref|YP_001315722.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   50S ribosomal protein L7/L12
ref|YP_001441128.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   50S ribosomal protein L7/L12
ref|YP_001574439.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   50S ribosomal protein L7/L12
ref|YP_042626.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   50S ribosomal protein L7/L12
ref|YP_185472.1 Staphylococcus aureus subsp. aureus COL RefSeq   50S ribosomal protein L7/L12
ref|YP_493228.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   50S ribosomal protein L7/L12
ref|YP_499094.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   50S ribosomal protein L7/L12
ref|ZP_03564412.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   50S ribosomal protein L7/L12
ref|ZP_03565516.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   50S ribosomal protein L7/L12
ref|ZP_04827962.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   50S ribosomal protein L7/L12
ref|ZP_04838863.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   50S ribosomal protein L7/L12
ref|ZP_04865310.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   50S ribosomal protein L7/L12
ref|ZP_04866713.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   50S ribosomal protein L7/L12
ref|ZP_05143935.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   50S ribosomal protein L7/L12
ref|ZP_05644340.1 Staphylococcus aureus A9781 RefSeq   50S ribosomal protein L7/L12
ref|ZP_05681233.1 Staphylococcus aureus A9763 RefSeq   50S ribosomal protein L12
ref|ZP_05683353.1 Staphylococcus aureus A9719 RefSeq   LSU ribosomal protein L7/L12
ref|ZP_05685519.1 Staphylococcus aureus A9635 RefSeq   LSU ribosomal protein L7/L12
ref|ZP_05690263.1 Staphylococcus aureus A9299 RefSeq   ribosomal protein L7/L12
ref|ZP_05692408.1 Staphylococcus aureus A8115 RefSeq   ribosomal protein L7/L12
ref|ZP_05694497.1 Staphylococcus aureus A6300 RefSeq   50S ribosomal protein L7/L12
ref|ZP_05696547.1 Staphylococcus aureus A6224 RefSeq   ribosomal protein L7/L12
ref|ZP_05700725.1 Staphylococcus aureus A5948 RefSeq   LSU ribosomal protein L12P
ref|ZP_05701762.1 Staphylococcus aureus A5937 RefSeq   50S ribosomal protein L7/L12
sp|A5IQ94 Staphylococcus aureus (strain JH9) SwissProt   50S ribosomal protein L7/L12
sp|A6TZ17 Staphylococcus aureus (strain JH1) SwissProt   50S ribosomal protein L7/L12
sp|A7WYW4 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   50S ribosomal protein L7/L12
sp|A8YZN8 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   50S ribosomal protein L7/L12
sp|P48860 Staphylococcus aureus (strain NCTC 8325) SwissProt   50S ribosomal protein L7/L12
sp|P66061 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   50S ribosomal protein L7/L12
sp|P66062 Staphylococcus aureus (strain MW2) SwissProt   50S ribosomal protein L7/L12
sp|P99154 Staphylococcus aureus (strain N315) SwissProt   50S ribosomal protein L7/L12
sp|Q2FJA0 Staphylococcus aureus (strain USA300) SwissProt   50S ribosomal protein L7/L12
sp|Q5HID5 Staphylococcus aureus (strain COL) SwissProt   50S ribosomal protein L7/L12
sp|Q6GBU7 Staphylococcus aureus (strain MSSA476) SwissProt   50S ribosomal protein L7/L12
sp|RL7_STAA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L7/L12
sp|RL7_STAA2 organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L7/L12
sp|RL7_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L7/L12
sp|RL7_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L7/L12
sp|RL7_STAA9 organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L7/L12
sp|RL7_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L7/L12
sp|RL7_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L7/L12
sp|RL7_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L7/L12
sp|RL7_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L7/L12
sp|RL7_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L7/L12
sp|RL7_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L7/L12
tr|C5N2W5 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   50S ribosomal protein L7/L12
tr|C5PXU4 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   50S ribosomal protein L7/L12
tr|C5QGR0 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   50S ribosomal protein L7/L12


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link

  Functional Coupling

Score Peg Function
7 fig|451515.3.peg.581 LSU ribosomal protein L33p @ LSU ribosomal protein L33p, zinc-dependent
71 fig|451515.3.peg.583 Transcription antitermination protein NusG
43 fig|451515.3.peg.584 LSU ribosomal protein L11p (L12e)
64 fig|451515.3.peg.585 LSU ribosomal protein L1p (L10Ae)
73 fig|451515.3.peg.586 LSU ribosomal protein L10p (P0)
20 fig|451515.3.peg.589 DNA-directed RNA polymerase beta subunit (EC 2.7.7.6)
14 fig|451515.3.peg.590 DNA-directed RNA polymerase beta' subunit (EC 2.7.7.6)


  Attributes

Help on Attributes

Key
Link Explains Key		 Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer

Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options

|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions
FIG search