The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.586: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: LSU ribosomal protein L10p (P0)
Translate Function Assignments



Context on contig NC_007793 from base 578481 to 589105 (10625 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
577 578481 578885 405 +   6     Mini-ribonuclease III ## 23S rRNA maturase locus|SAUSA300_0516, protein_id|YP_493219.1, gi|87161610, geneID|3913465
578 578893 579639 747 + 7 10     23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-) ## LSU rRNA Gm2251 locus|SAUSA300_0517, protein_id|YP_493220.1, gi|87162210, geneID|3914853
579 579639 580163 525 + -1 11     Hypothetical protein DUF901, similar to C-terminal domain of ribosome protection-type Tc-resistance proteins locus|SAUSA300_0518, protein_id|YP_493221.1, gi|87160481, geneID|3913336
580 580244 580813 570 + 80     2: 8 10   RNA polymerase sporulation specific sigma factor SigH locus|SAUSA300_0519, protein_id|YP_493222.1, gi|87161083, geneID|3914269
581 580928 581071 144 + 114 7 3: 3 2 9   LSU ribosomal protein L33p @ LSU ribosomal protein L33p, zinc-dependent  
582 581127 581309 183 + 55 6 1: 1   Preprotein translocase subunit SecE (TC 3.A.5.1.1) gene_name|secE, locus|SAUSA300_0520, protein_id|YP_493223.1, gi|87161634, geneID|3913684
583 581322 581870 549 + 12 69 2: 7 1   Transcription antitermination protein NusG gene_name|nusG, locus|SAUSA300_0521, protein_id|YP_493224.1, gi|87160422, geneID|3913140
584 582051 582473 423 + 180 38 5: 4 3 2 5 1   LSU ribosomal protein L11p (L12e) gene_name|rplK, locus|SAUSA300_0522, protein_id|YP_493225.1, gi|87161133, geneID|3913722
585 582681 583373 693 + 207 59 6: 4 3 2 6 5 1   LSU ribosomal protein L1p (L10Ae) gene_name|rplA, locus|SAUSA300_0523, protein_id|YP_493226.1, gi|87162295, geneID|3913604
586 583645 584145 501 + 271   4: 4 3 2 1   LSU ribosomal protein L10p (P0) gene_name|rplJ, locus|SAUSA300_0524, protein_id|YP_493227.1, gi|87160740, geneID|3913441
587 584188 584556 369 + 42 73 5: 4 3 2 5 1   LSU ribosomal protein L7p/L12p (P1/P2) gene_name|rplL, locus|SAUSA300_0525, protein_id|YP_493228.1, gi|87161455, geneID|3914128
588 584731 585339 609 + 174 7     16S rRNA (guanine(1207)-N(2))-methyltransferase (EC 2.1.1.172) ## RsmC locus|SAUSA300_0526, protein_id|YP_493229.1, gi|87161944, geneID|3913701
589 585554 589105 3552 + 214 17 2: 11 6   DNA-directed RNA polymerase beta subunit (EC 2.7.7.6) gene_name|rpoB, locus|SAUSA300_0527, protein_id|YP_493230.2, gi|162138570, geneID|3914836

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Ribospme_LSU_Symbiont vcrecy LSU ribosomal protein L10p (P0)
LSU_ribosomal_proteins_cluster LSU ribosomal protein L10p (P0)
Ribosome_LSU_bacterial gjo LSU ribosomal protein L10p (P0)
Single-copy_ribosomal_proteins gjo LSU ribosomal protein L10p (P0)


  Protein Sequence

>fig|451515.3.peg.586 LSU ribosomal protein L10p (P0)
MSAIIEAKKQLVDEIAEVLSNSVSTVIVDYRGLTVAEVTDLRSQLREAGVEYKVYKNTMV
RRAAEKAGIEGLDEFLTGPTAIATSSEDAVAAAKVISGFAKDHEALEIKSGVMEGNVITA
EEVKTVGSLPSHDGLVSMLLSVLQAPVRNFAYAVKAIGEQKEENAE

MD5 = a68e196d5d31cefd80efd85617681cf5


  DNA Sequence

>fig|451515.3.peg.586 LSU ribosomal protein L10p (P0)
atgtctgctatcattgaagctaaaaaacaactagttgatgaaattgctgaggtactatca
aattcagtttcaacagtaatcgttgactaccgtggattaacagtagctgaagttactgac
ttacgttcacaattacgtgaagctggtgttgagtataaagtatacaaaaacactatggta
cgtcgtgcagctgaaaaagctggtatcgaaggcttagatgaattcttaacaggtcctact
gctattgcaacttcaagtgaagatgctgtagctgcagcgaaagtaatttctggatttgct
aaagatcatgaagcattagaaattaaatcaggcgttatggaaggcaatgttattacagca
gaagaagttaaaactgttggttcattaccttcacacgatggtcttgtatctatgctttta
tcagtattacaagctcctgtacgcaacttcgcttatgcggttaaagctattggagaacaa
aaagaagaaaacgctgaataa


  DNA with Flanking Sequence

>fig|451515.3.peg.586 LSU ribosomal protein L10p (P0)
aatcaaagctggtaaagtagaatatcgtgctgaaaaagctggtatcgtacatgcatcaat
tggtaaagtttcatttactgatgaacaattaattgaaaacttcaatactttacaagatgt
attagctaaagctaaaccatcatctgctaaaggtacatacttcaaatctgttgctgtaac
tacaacaatgggtcctggagttaaaattgatactgcaagtttcaaataataaatgatata
aacaattacaggctgaaagaaatatctttcagtctgtaaaaatatattgacaataagtaa
tttccaagttatattacttattgtgattattttacctaagacagtaggagttatttataa
cttaaaatttatcctgccgaggctaaaattgacttgaacgtgatgatctatgatctttca
agcactttttgccgtgggtagaaagtgctttttttattaattttaaaaaaagcaccaaaa
atttaaatggaggtgtctgaatgtctgctatcattgaagctaaaaaacaactagttgatg
aaattgctgaggtactatcaaattcagtttcaacagtaatcgttgactaccgtggattaa
cagtagctgaagttactgacttacgttcacaattacgtgaagctggtgttgagtataaag
tatacaaaaacactatggtacgtcgtgcagctgaaaaagctggtatcgaaggcttagatg
aattcttaacaggtcctactgctattgcaacttcaagtgaagatgctgtagctgcagcga
aagtaatttctggatttgctaaagatcatgaagcattagaaattaaatcaggcgttatgg
aaggcaatgttattacagcagaagaagttaaaactgttggttcattaccttcacacgatg
gtcttgtatctatgcttttatcagtattacaagctcctgtacgcaacttcgcttatgcgg
ttaaagctattggagaacaaaaagaagaaaacgctgaataatttttagcgtaaaaaaatt
aaaaataatggaggaattataaaatggctaatcatgaacaaatcattgaagcgattaaag
aaatgtcagtattagaattaaacgacttagtaaaagcaattgaagaagaatttggtgtaa
ctgcagctgctccagtagcagtagcaggtgcagctggtggcgctgacgctgcagcagaaa
aaactgaatttgacgttgagttaacttcagctggttcatctaaaatcaaagttgttaaag
ctgttaaagaagcaactggtttaggattaaaagatgctaaagaattagtagacggagctc
ctaaagtaatcaaagaagctttacctaaagaagaagctgaaaaacttaaagaacaattag
aagaagttggagctactgtagaattaaaataattcaagtatcttaaacttaataatcaaa
gttttatagcaagtattgctataatataatgattctttgagaagttaaaaccccgttatt
t


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003735       F:structural constituent of ribosome
GO:0005840       C:ribosome
GO:0006412       P:translation
GO:0042254       P:ribosome biogenesis
cmr|NT01SA0541 Staphylococcus aureus N315     ribosomal protein L10
cmr|NT02SA0545 Staphylococcus aureus Mu50     50S ribosomal protein
cmr|NT03SA0552 Staphylococcus aureus MW2     ribosomal protein L10
cmr|NT05SA0471 Staphylococcus aureus NCTC 8325     50S ribosomal protein L10
cmr|NT08SA0546 Staphylococcus aureus subsp. aureus MRSA252     50S ribosomal protein L10
cmr|NT11SA0503 Staphylococcus aureus RF122     50S ribosomal protein L10
cmr|SACOL0585 Staphylococcus aureus subsp. aureus COL     ribosomal protein L10
cmr|SAUSA300_0524 Staphylococcus aureus subsp. aureus USA300-FPR3757     ribosomal protein L10
dbj|BAB41728.1 Staphylococcus aureus subsp. aureus N315     50S ribosomal protein L10
dbj|BAB56701.1 Staphylococcus aureus subsp. aureus Mu50     50S ribosomal protein L10
dbj|BAB94359.1 Staphylococcus aureus subsp. aureus MW2     50S ribosomal protein L10
dbj|BAF66773.1 Staphylococcus aureus subsp. aureus str. Newman     50S ribosomal protein L10
dbj|BAF77420.1 Staphylococcus aureus subsp. aureus Mu3     50S ribosomal protein L10
emb|CAG39565.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   50S ribosomal protein L10
emb|CAI80178.1 Staphylococcus aureus RF122 EMBL   50S ribosomal protein L10
fig|158878.1.peg.539 Staphylococcus aureus subsp. aureus Mu50 FIG   LSU ribosomal protein L10p (P0)
fig|158878.14.peg.545 Staphylococcus aureus subsp. aureus Mu50 FIG   LSU ribosomal protein L10p (P0)
fig|158879.1.peg.511 Staphylococcus aureus subsp. aureus N315 FIG   LSU ribosomal protein L10p (P0)
fig|158879.11.peg.523 Staphylococcus aureus subsp. aureus N315 FIG   LSU ribosomal protein L10p (P0)
fig|196620.1.peg.494 Staphylococcus aureus subsp. aureus MW2 FIG   LSU ribosomal protein L10p (P0)
fig|196620.5.peg.523 Staphylococcus aureus subsp. aureus MW2 FIG   LSU ribosomal protein L10p (P0)
fig|273036.3.peg.78 Staphylococcus aureus RF122 FIG   LSU ribosomal protein L10p (P0)
fig|273036.6.peg.531 Staphylococcus aureus RF122 FIG   LSU ribosomal protein L10p (P0)
fig|282458.1.peg.516 Staphylococcus aureus subsp. aureus MRSA252 FIG   LSU ribosomal protein L10p (P0)
fig|282458.4.peg.552 Staphylococcus aureus subsp. aureus MRSA252 FIG   LSU ribosomal protein L10p (P0)
fig|359786.13.peg.614 Staphylococcus aureus subsp. aureus JH9 FIG   LSU ribosomal protein L10p (P0)
fig|359786.3.peg.483 Staphylococcus aureus subsp. aureus JH9 FIG   LSU ribosomal protein L10p (P0)
fig|359787.11.peg.604 Staphylococcus aureus subsp. aureus JH1 FIG   LSU ribosomal protein L10p (P0)
fig|359787.3.peg.402 Staphylococcus aureus subsp. aureus JH1 FIG   LSU ribosomal protein L10p (P0)
fig|367830.3.peg.455 Staphylococcus aureus subsp. aureus USA300 FIG   LSU ribosomal protein L10p (P0)
fig|418127.4.peg.505 Staphylococcus aureus subsp. aureus Mu3 FIG   LSU ribosomal protein L10p (P0)
fig|418127.6.peg.542 Staphylococcus aureus subsp. aureus Mu3 FIG   LSU ribosomal protein L10p (P0)
fig|426430.6.peg.503 Staphylococcus aureus subsp. aureus str. Newman FIG   LSU ribosomal protein L10p (P0)
fig|426430.8.peg.548 Staphylococcus aureus subsp. aureus str. Newman FIG   LSU ribosomal protein L10p (P0)
fig|450394.6.peg.444 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   LSU ribosomal protein L10p (P0)
fig|451516.9.peg.576 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   LSU ribosomal protein L10p (P0)
fig|452948.4.peg.1604 Staphylococcus aureus 930918-3 FIG   LSU ribosomal protein L10p (P0)
fig|455227.3.peg.1615 Staphylococcus aureus D30 FIG   LSU ribosomal protein L10p (P0)
fig|505321.3.peg.1154 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   LSU ribosomal protein L10p (P0)
fig|546342.3.peg.2667 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   LSU ribosomal protein L10p (P0)
fig|546343.3.peg.1046 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   LSU ribosomal protein L10p (P0)
fig|548470.3.peg.1561 Staphylococcus aureus subsp. aureus MN8 FIG   LSU ribosomal protein L10p (P0)
fig|548473.3.peg.1391 Staphylococcus aureus subsp. aureus TCH60 FIG   LSU ribosomal protein L10p (P0)
fig|548474.3.peg.2105 Staphylococcus aureus subsp. aureus TCH130 FIG   LSU ribosomal protein L10p (P0)
fig|548475.3.peg.23 Staphylococcus aureus subsp. aureus TCH70 FIG   LSU ribosomal protein L10p (P0)
fig|553565.3.peg.516 Staphylococcus aureus A5937 FIG   LSU ribosomal protein L10p (P0)
fig|553567.3.peg.2225 Staphylococcus aureus A5948 FIG   LSU ribosomal protein L10p (P0)
fig|553568.3.peg.749 Staphylococcus aureus A6224 FIG   LSU ribosomal protein L10p (P0)
fig|553571.3.peg.1368 Staphylococcus aureus A6300 FIG   LSU ribosomal protein L10p (P0)
fig|553573.3.peg.1887 Staphylococcus aureus A8115 FIG   LSU ribosomal protein L10p (P0)
fig|553574.3.peg.2284 Staphylococcus aureus A8117 FIG   LSU ribosomal protein L10p (P0)
fig|553577.3.peg.2311 Staphylococcus aureus A8796 FIG   LSU ribosomal protein L10p (P0)
fig|553580.3.peg.2059 Staphylococcus aureus A8819 FIG   LSU ribosomal protein L10p (P0)
fig|553581.3.peg.2361 Staphylococcus aureus A9299 FIG   LSU ribosomal protein L10p (P0)
fig|553583.3.peg.126 Staphylococcus aureus A9635 FIG   LSU ribosomal protein L10p (P0)
fig|553588.3.peg.736 Staphylococcus aureus A9719 FIG   LSU ribosomal protein L10p (P0)
fig|553590.4.peg.2364 Staphylococcus aureus A9754 FIG   LSU ribosomal protein L10p (P0)
fig|553592.3.peg.1254 Staphylococcus aureus A9763 FIG   LSU ribosomal protein L10p (P0)
fig|553594.3.peg.1858 Staphylococcus aureus A9765 FIG   LSU ribosomal protein L10p (P0)
fig|553596.3.peg.2288 Staphylococcus aureus A9781 FIG   LSU ribosomal protein L10p (P0)
fig|553601.3.peg.2268 Staphylococcus aureus A10102 FIG   LSU ribosomal protein L10p (P0)
fig|585143.3.peg.1049 Staphylococcus aureus subsp. aureus 55/2053 FIG   LSU ribosomal protein L10p (P0)
fig|585144.3.peg.1060 Staphylococcus aureus subsp. aureus 58-424 FIG   LSU ribosomal protein L10p (P0)
fig|585145.3.peg.1042 Staphylococcus aureus subsp. aureus 65-1322 FIG   LSU ribosomal protein L10p (P0)
fig|585146.3.peg.1047 Staphylococcus aureus subsp. aureus 68-397 FIG   LSU ribosomal protein L10p (P0)
fig|585147.3.peg.65 Staphylococcus aureus subsp. aureus A017934/97 FIG   LSU ribosomal protein L10p (P0)
fig|585148.3.peg.65 Staphylococcus aureus subsp. aureus Btn1260 FIG   LSU ribosomal protein L10p (P0)
fig|585149.6.peg.670 Staphylococcus aureus subsp. aureus C101 FIG   LSU ribosomal protein L10p (P0)
fig|585150.3.peg.1090 Staphylococcus aureus subsp. aureus C160 FIG   LSU ribosomal protein L10p (P0)
fig|585151.3.peg.159 Staphylococcus aureus subsp. aureus C427 FIG   LSU ribosomal protein L10p (P0)
fig|585152.3.peg.456 Staphylococcus aureus subsp. aureus D139 FIG   LSU ribosomal protein L10p (P0)
fig|585153.3.peg.1100 Staphylococcus aureus subsp. aureus E1410 FIG   LSU ribosomal protein L10p (P0)
fig|585154.3.peg.499 Staphylococcus aureus subsp. aureus EMRSA16 FIG   LSU ribosomal protein L10p (P0)
fig|585155.3.peg.1082 Staphylococcus aureus subsp. aureus H19 FIG   LSU ribosomal protein L10p (P0)
fig|585156.3.peg.66 Staphylococcus aureus subsp. aureus M1015 FIG   LSU ribosomal protein L10p (P0)
fig|585157.3.peg.188 Staphylococcus aureus subsp. aureus M809 FIG   LSU ribosomal protein L10p (P0)
fig|585158.3.peg.1040 Staphylococcus aureus subsp. aureus M876 FIG   LSU ribosomal protein L10p (P0)
fig|585159.3.peg.654 Staphylococcus aureus subsp. aureus M899 FIG   LSU ribosomal protein L10p (P0)
fig|585160.3.peg.63 Staphylococcus aureus subsp. aureus WBG10049 FIG   LSU ribosomal protein L10p (P0)
fig|585161.3.peg.402 Staphylococcus aureus subsp. aureus WW2703/97 FIG   LSU ribosomal protein L10p (P0)
fig|585891.3.peg.544 Staphylococcus aureus subsp. aureus Mu50-omega FIG   LSU ribosomal protein L10p (P0)
fig|644279.4.peg.611 Staphylococcus aureus subsp. aureus 132 FIG   LSU ribosomal protein L10p (P0)
fig|680649.3.peg.1134 Staphylococcus aureus subsp. aureus MR1 FIG   LSU ribosomal protein L10p (P0)
fig|681288.4.peg.492 Staphylococcus aureus subsp. aureus ED98 FIG   LSU ribosomal protein L10p (P0)
fig|703339.3.peg.520 Staphylococcus aureus 04-02981 FIG   LSU ribosomal protein L10p (P0)
fig|93061.3.peg.506 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   LSU ribosomal protein L10p (P0)
fig|93061.5.peg.467 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   LSU ribosomal protein L10p (P0)
fig|93062.19.peg.569 Staphylococcus aureus subsp. aureus COL FIG   LSU ribosomal protein L10p (P0)
fig|93062.4.peg.1038 Staphylococcus aureus subsp. aureus COL FIG   LSU ribosomal protein L10p (P0)
gb|AAW37695.1 Staphylococcus aureus subsp. aureus COL     ribosomal protein L10
gb|ABD21228.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     ribosomal protein L10
gb|ABD29669.1 Staphylococcus aureus subsp. aureus NCTC 8325     ribosomal protein L10
gb|ABQ48366.1 Staphylococcus aureus subsp. aureus JH9     LSU ribosomal protein L10P
gb|ABR51434.1 Staphylococcus aureus subsp. aureus JH1     ribosomal protein L10
gb|ABX28559.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     ribosomal protein L10
gb|EEI95942.1 Staphylococcus aureus subsp. aureus MN8     50S ribosomal protein L10
gb|EEJ62031.1 Staphylococcus aureus subsp. aureus TCH60     50S ribosomal protein L10
gb|EES55647.1 Staphylococcus aureus subsp. aureus TCH70     50S ribosomal protein L10
gb|EES93838.1 Staphylococcus aureus subsp. aureus USA300_TCH959     50S ribosomal protein L10
gb|EES98205.1 Staphylococcus aureus subsp. aureus TCH130     50S ribosomal protein L10
gb|EEV04346.1 Staphylococcus aureus subsp. aureus 55/2053     ribosomal protein L10
gb|EEV06987.1 Staphylococcus aureus subsp. aureus 65-1322     ribosomal protein L10
gb|EEV09755.1 Staphylococcus aureus subsp. aureus 68-397     ribosomal protein L10
gb|EEV12209.1 Staphylococcus aureus subsp. aureus E1410     50S ribosomal protein L10
gb|EEV14873.1 Staphylococcus aureus subsp. aureus M876     ribosomal protein L10
gb|EEV27674.1 Staphylococcus aureus A9781     50S ribosomal protein L10
gb|EEV64765.1 Staphylococcus aureus A9763     50S ribosomal protein L10
gb|EEV68007.1 Staphylococcus aureus A9719     ribosomal protein L10
gb|EEV71194.1 Staphylococcus aureus A9635     ribosomal protein L10
gb|EEV71668.1 Staphylococcus aureus A9299     ribosomal protein L10
gb|EEV74687.1 Staphylococcus aureus A8115     ribosomal protein L10
gb|EEV77879.1 Staphylococcus aureus A6300     ribosomal protein L10
gb|EEV81189.1 Staphylococcus aureus A6224     ribosomal protein L10
gb|EEV82451.1 Staphylococcus aureus A5948     ribosomal protein L10
gb|EEV86799.1 Staphylococcus aureus A5937     50S ribosomal protein L10
gb|EEW44717.1 Staphylococcus aureus 930918-3     50S ribosomal protein L10
gb|EEW46895.1 Staphylococcus aureus D30     50S ribosomal protein L10
gi|122540133 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L10
gi|13700430 Staphylococcus aureus subsp. aureus N315 NCBI   50S ribosomal protein L10
gi|14246307 Staphylococcus aureus subsp. aureus Mu50 NCBI   50S ribosomal protein L10
gi|147740068 Staphylococcus aureus subsp. aureus JH9 NCBI   LSU ribosomal protein L10P
gi|148266999 Staphylococcus aureus subsp. aureus JH9 NCBI   50S ribosomal protein L10
gi|149945498 Staphylococcus aureus subsp. aureus JH1 NCBI   ribosomal protein L10
gi|150373513 Staphylococcus aureus subsp. aureus str. Newman NCBI   50S ribosomal protein L10
gi|150393046 Staphylococcus aureus subsp. aureus JH1 NCBI   50S ribosomal protein L10
gi|151220713 Staphylococcus aureus subsp. aureus str. Newman NCBI   50S ribosomal protein L10
gi|156721003 Staphylococcus aureus subsp. aureus Mu3 NCBI   50S ribosomal protein L10
gi|156978868 Staphylococcus aureus subsp. aureus Mu3 NCBI   50S ribosomal protein L10
gi|15923529 Staphylococcus aureus subsp. aureus Mu50 NCBI   50S ribosomal protein L10
gi|15926217 Staphylococcus aureus subsp. aureus N315 NCBI   50S ribosomal protein L10
gi|160367588 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   ribosomal protein L10
gi|161508779 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   50S ribosomal protein L10
gi|166230076 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L10
gi|172048776 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L10
gi|189040938 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L10
gi|189040939 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L10
gi|189040940 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L10
gi|21203659 Staphylococcus aureus subsp. aureus MW2 NCBI   50S ribosomal protein L10
gi|21282223 Staphylococcus aureus subsp. aureus MW2 NCBI   50S ribosomal protein L10
gi|221139612 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   50S ribosomal protein L10
gi|221141024 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   50S ribosomal protein L10
gi|227246183 Staphylococcus aureus subsp. aureus MN8 NCBI   50S ribosomal protein L10
gi|227557413 Staphylococcus aureus subsp. aureus MN8 NCBI   50S ribosomal protein L10
gi|227852233 Staphylococcus aureus subsp. aureus TCH60 NCBI   50S ribosomal protein L10
gi|227899470 Staphylococcus aureus subsp. aureus TCH60 NCBI   50S ribosomal protein L10
gi|251802990 Staphylococcus aureus subsp. aureus TCH70 NCBI   50S ribosomal protein L10
gi|251813488 Staphylococcus aureus subsp. aureus TCH70 NCBI   50S ribosomal protein L10
gi|253315649 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   50S ribosomal protein L10
gi|253725109 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   50S ribosomal protein L10
gi|253729476 Staphylococcus aureus subsp. aureus TCH130 NCBI   50S ribosomal protein L10
gi|253731144 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   50S ribosomal protein L10
gi|253732547 Staphylococcus aureus subsp. aureus TCH130 NCBI   50S ribosomal protein L10
gi|255005333 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   50S ribosomal protein L10
gi|257272223 Staphylococcus aureus subsp. aureus 55/2053 NCBI   ribosomal protein L10
gi|257275514 Staphylococcus aureus subsp. aureus 65-1322 NCBI   ribosomal protein L10
gi|257279154 Staphylococcus aureus subsp. aureus 68-397 NCBI   ribosomal protein L10
gi|257282074 Staphylococcus aureus subsp. aureus E1410 NCBI   50S ribosomal protein L10
gi|257284754 Staphylococcus aureus subsp. aureus M876 NCBI   ribosomal protein L10
gi|257424653 Staphylococcus aureus subsp. aureus 55/2053 NCBI   ribosomal protein L10
gi|257427321 Staphylococcus aureus subsp. aureus 65-1322 NCBI   ribosomal protein L10
gi|257429957 Staphylococcus aureus subsp. aureus 68-397 NCBI   ribosomal protein L10
gi|257432659 Staphylococcus aureus subsp. aureus E1410 NCBI   50S ribosomal protein L10
gi|257435563 Staphylococcus aureus subsp. aureus M876 NCBI   ribosomal protein L10
gi|257789334 Staphylococcus aureus A9781 NCBI   50S ribosomal protein L10
gi|257795362 Staphylococcus aureus A9781 NCBI   50S ribosomal protein L10
gi|257840302 Staphylococcus aureus A9763 NCBI   50S ribosomal protein L10
gi|257843601 Staphylococcus aureus A9719 NCBI   ribosomal protein L10
gi|257847186 Staphylococcus aureus A9635 NCBI   ribosomal protein L10
gi|257847669 Staphylococcus aureus A9299 NCBI   ribosomal protein L10
gi|257850742 Staphylococcus aureus A8115 NCBI   ribosomal protein L10
gi|257854934 Staphylococcus aureus A6300 NCBI   ribosomal protein L10
gi|257858302 Staphylococcus aureus A6224 NCBI   ribosomal protein L10
gi|257859601 Staphylococcus aureus A5948 NCBI   ribosomal protein L10
gi|257864045 Staphylococcus aureus A5937 NCBI   50S ribosomal protein L10
gi|258408951 Staphylococcus aureus A9763 NCBI   50S ribosomal protein L10
gi|258420411 Staphylococcus aureus A9719 NCBI   ribosomal protein L10
gi|258422614 Staphylococcus aureus A9635 NCBI   ribosomal protein L10
gi|258439332 Staphylococcus aureus A9299 NCBI   ribosomal protein L10
gi|258444072 Staphylococcus aureus A8115 NCBI   ribosomal protein L10
gi|258446340 Staphylococcus aureus A6300 NCBI   ribosomal protein L10
gi|258448433 Staphylococcus aureus A6224 NCBI   ribosomal protein L10
gi|258452728 Staphylococcus aureus A5948 NCBI   ribosomal protein L10
gi|258453789 Staphylococcus aureus A5937 NCBI   50S ribosomal protein L10
gi|259159673 Staphylococcus aureus 930918-3 NCBI   50S ribosomal protein L10
gi|259162322 Staphylococcus aureus D30 NCBI   50S ribosomal protein L10
gi|49240898 Staphylococcus aureus subsp. aureus MRSA252 NCBI   50S ribosomal protein L10
gi|49482769 Staphylococcus aureus subsp. aureus MRSA252 NCBI   50S ribosomal protein L10
gi|54039083 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L10
gi|54039093 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L10
gi|54041813 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L10
gi|56749586 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L10
gi|57285601 Staphylococcus aureus subsp. aureus COL NCBI   ribosomal protein L10
gi|57651415 Staphylococcus aureus subsp. aureus COL NCBI   50S ribosomal protein L10
gi|81695154 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L10
gi|82655778 Staphylococcus aureus RF122 NCBI   50S ribosomal protein L10
gi|82750247 Staphylococcus aureus RF122 NCBI   50S ribosomal protein L10
gi|87126714 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   ribosomal protein L10
gi|87160740 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   50S ribosomal protein L10
gi|87201859 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   ribosomal protein L10
gi|88194301 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   50S ribosomal protein L10
gi|97181995 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L10
gi|97181999 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L10
img|637092127 Staphylococcus aureus aureus N315 IMG   50S ribosomal protein L10
img|637099054 Staphylococcus aureus aureus Mu50 IMG   50S ribosomal protein L10
img|637151367 Staphylococcus aureus aureus COL IMG   ribosomal protein L10
img|637154014 Staphylococcus aureus aureus MRSA252 IMG   50S ribosomal protein L10
img|637298254 Staphylococcus aureus aureus MW2 IMG   50S ribosomal protein L10
img|637815455 Staphylococcus aureus RF122 IMG   50S ribosomal protein L10
img|637887178 Staphylococcus aureus aureus USA300 IMG   ribosomal protein L10
img|637893183 Staphylococcus aureus aureus NCTC 8325 IMG   ribosomal protein L10
img|639109666 Staphylococcus aureus aureus JH1 IMG   Ribosomal protein L10
img|640564913 Staphylococcus aureus aureus JH9 IMG   ribosomal protein L10
img|640778663 Staphylococcus aureus aureus JH1 IMG   ribosomal protein L10
img|640794877 Staphylococcus aureus aureus Newman IMG   50S ribosomal protein L10
img|640903276 Staphylococcus aureus aureus Mu3 IMG   50S ribosomal protein L10
img|641308505 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   ribosomal protein L10
img|641772878 Staphylococcus aureus aureus USA300_TCH959 IMG   ribosomal protein L10
kegg|saa:SAUSA300_0524 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   50S ribosomal protein L10
kegg|sab:SAB0490 Staphylococcus aureus RF122 KEGG   50S ribosomal protein L10
kegg|sac:SACOL0585 Staphylococcus aureus subsp. aureus COL KEGG   50S ribosomal protein L10
kegg|sae:NWMN_0501 Staphylococcus aureus subsp. aureus Newman KEGG   50S ribosomal protein L10
kegg|sah:SaurJH1_0576 Staphylococcus aureus subsp. aureus JH1 KEGG   50S ribosomal protein L10
kegg|saj:SaurJH9_0562 Staphylococcus aureus subsp. aureus JH9 KEGG   50S ribosomal protein L10
kegg|sam:MW0494 Staphylococcus aureus subsp. aureus MW2 KEGG   50S ribosomal protein L10
kegg|sao:SAOUHSC_00520 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   50S ribosomal protein L10
kegg|sar:SAR0544   KEGG   50S ribosomal protein L10
kegg|sau:SA0497   KEGG   50S ribosomal protein L10
kegg|sav:SAV0539   KEGG   50S ribosomal protein L10
kegg|saw:SAHV_0537 Staphylococcus aureus subsp. aureus Mu3 KEGG   50S ribosomal protein L10
kegg|sax:USA300HOU_0533 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   50S ribosomal protein L10
ref|NP_371063.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   50S ribosomal protein L10
ref|NP_373750.1 Staphylococcus aureus subsp. aureus N315 RefSeq   50S ribosomal protein L10
ref|NP_645311.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   50S ribosomal protein L10
ref|YP_001245942.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   50S ribosomal protein L10
ref|YP_001315721.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   50S ribosomal protein L10
ref|YP_001331535.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   50S ribosomal protein L10
ref|YP_001441127.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   50S ribosomal protein L10
ref|YP_001574438.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   50S ribosomal protein L10
ref|YP_039993.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   50S ribosomal protein L10
ref|YP_185471.1 Staphylococcus aureus subsp. aureus COL RefSeq   50S ribosomal protein L10
ref|YP_415988.1 Staphylococcus aureus RF122 RefSeq   50S ribosomal protein L10
ref|YP_493227.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   50S ribosomal protein L10
ref|YP_499093.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   50S ribosomal protein L10
ref|ZP_03564411.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   50S ribosomal protein L10
ref|ZP_03565517.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   50S ribosomal protein L10
ref|ZP_03987460.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   50S ribosomal protein L10
ref|ZP_04017275.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   50S ribosomal protein L10
ref|ZP_04827961.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   50S ribosomal protein L10
ref|ZP_04838862.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   50S ribosomal protein L10
ref|ZP_04865309.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   50S ribosomal protein L10
ref|ZP_04866712.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   50S ribosomal protein L10
ref|ZP_05143934.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   50S ribosomal protein L10
ref|ZP_05601080.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   ribosomal protein L10
ref|ZP_05603720.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   ribosomal protein L10
ref|ZP_05606341.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   ribosomal protein L10
ref|ZP_05609019.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   50S ribosomal protein L10
ref|ZP_05611611.1 Staphylococcus aureus subsp. aureus M876 RefSeq   ribosomal protein L10
ref|ZP_05644341.1 Staphylococcus aureus A9781 RefSeq   50S ribosomal protein L10
ref|ZP_05681232.1 Staphylococcus aureus A9763 RefSeq   50S ribosomal protein L10
ref|ZP_05683354.1 Staphylococcus aureus A9719 RefSeq   ribosomal protein L10
ref|ZP_05685520.1 Staphylococcus aureus A9635 RefSeq   ribosomal protein L10
ref|ZP_05690264.1 Staphylococcus aureus A9299 RefSeq   ribosomal protein L10
ref|ZP_05692409.1 Staphylococcus aureus A8115 RefSeq   ribosomal protein L10
ref|ZP_05694498.1 Staphylococcus aureus A6300 RefSeq   ribosomal protein L10
ref|ZP_05696548.1 Staphylococcus aureus A6224 RefSeq   ribosomal protein L10
ref|ZP_05700726.1 Staphylococcus aureus A5948 RefSeq   ribosomal protein L10
ref|ZP_05701763.1 Staphylococcus aureus A5937 RefSeq   50S ribosomal protein L10
sp|A5IQ93 Staphylococcus aureus (strain JH9) SwissProt   50S ribosomal protein L10
sp|A6QEJ1 Staphylococcus aureus (strain Newman) SwissProt   50S ribosomal protein L10
sp|A6TZ16 Staphylococcus aureus (strain JH1) SwissProt   50S ribosomal protein L10
sp|A7WYW2 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   50S ribosomal protein L10
sp|A8YZN7 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   50S ribosomal protein L10
sp|P66048 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   50S ribosomal protein L10
sp|P66049 Staphylococcus aureus (strain MW2) SwissProt   50S ribosomal protein L10
sp|P99155 Staphylococcus aureus (strain N315) SwissProt   50S ribosomal protein L10
sp|Q2FJA1 Staphylococcus aureus (strain USA300) SwissProt   50S ribosomal protein L10
sp|Q2G0N9 Staphylococcus aureus (strain NCTC 8325) SwissProt   50S ribosomal protein L10
sp|Q2YSC2 Staphylococcus aureus (strain bovine RF122 / ET3-1) SwissProt   50S ribosomal protein L10
sp|Q5HID6 Staphylococcus aureus (strain COL) SwissProt   50S ribosomal protein L10
sp|Q6GJC9 Staphylococcus aureus (strain MRSA252) SwissProt   50S ribosomal protein L10
sp|RL10_STAA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L10
sp|RL10_STAA2 organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L10
sp|RL10_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L10
sp|RL10_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L10
sp|RL10_STAA9 organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L10
sp|RL10_STAAB organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L10
sp|RL10_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L10
sp|RL10_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L10
sp|RL10_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L10
sp|RL10_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L10
sp|RL10_STAAR organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L10
sp|RL10_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L10
sp|RL10_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L10
tr|C2GA92 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   50S ribosomal protein L10
tr|C2K5S0 Staphylococcus aureus subsp. aureus MN8 TrEMBL   50S ribosomal protein L10
tr|C5N2W4 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   50S ribosomal protein L10
tr|C5PXU3 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   50S ribosomal protein L10
tr|C5QGQ9 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   50S ribosomal protein L10


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
6 fig|451515.3.peg.577 Mini-ribonuclease III ## 23S rRNA maturase
10 fig|451515.3.peg.578 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-) ## LSU rRNA Gm2251
11 fig|451515.3.peg.579 Hypothetical protein DUF901, similar to C-terminal domain of ribosome protection-type Tc-resistance proteins
7 fig|451515.3.peg.581 LSU ribosomal protein L33p @ LSU ribosomal protein L33p, zinc-dependent
6 fig|451515.3.peg.582 Preprotein translocase subunit SecE (TC 3.A.5.1.1)
69 fig|451515.3.peg.583 Transcription antitermination protein NusG
38 fig|451515.3.peg.584 LSU ribosomal protein L11p (L12e)
59 fig|451515.3.peg.585 LSU ribosomal protein L1p (L10Ae)
73 fig|451515.3.peg.587 LSU ribosomal protein L7p/L12p (P1/P2)
7 fig|451515.3.peg.588 16S rRNA (guanine(1207)-N(2))-methyltransferase (EC 2.1.1.172) ## RsmC
17 fig|451515.3.peg.589 DNA-directed RNA polymerase beta subunit (EC 2.7.7.6)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search