The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.554: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: RNA binding protein, contains ribosomal protein S1 domain
Translate Function Assignments



Context on contig NC_007793 from base 537797 to 550667 (12871 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
549 537797 541303 3507 +   9 3: 9 14 1   Transcription-repair coupling factor gene_name|mfd, locus|SAUSA300_0481, protein_id|YP_493190.1, gi|87160796, geneID|3914616
550 541293 542819 1527 + -11 12     Low temperature requirement B protein locus|SAUSA300_0482, protein_id|YP_493191.1, gi|87161203, geneID|3914914
551 542819 544012 1194 + -1 13 1: 4   possible tetrapyrrole methyltransferase domain / Nucleoside triphosphate pyrophosphohydrolase MazG (EC 3.6.1.8) locus|SAUSA300_0483, protein_id|YP_493192.1, gi|87160529, geneID|3914009
552 544009 544272 264 + -4 20 4: 5 1 13 15   Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog) locus|SAUSA300_0484, protein_id|YP_493193.1, gi|87161449, geneID|3914122
553 544290 544682 393 + 17 6 3: 2 1 3   Cell division protein DivIC (FtsB), stabilizes FtsL against RasP cleavage locus|SAUSA300_0485, protein_id|YP_493194.1, gi|87160736, geneID|3913437
554 544787 545188 402 + 104   1: 1   RNA binding protein, contains ribosomal protein S1 domain locus|SAUSA300_0486, protein_id|YP_493195.1, gi|87160186, geneID|3913254
555 545368 546663 1296 + 179 11 5: 16 11 7 12 1   tRNA(Ile)-lysidine synthetase (EC 6.3.4.19) locus|SAUSA300_0487, protein_id|YP_493196.1, gi|87161906, geneID|3912997
556 546668 547207 540 + 4 9 3: 8 6 1   Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8) gene_name|hpt, locus|SAUSA300_0488, protein_id|YP_493197.1, gi|87161299, geneID|3914718
557 547464 549557 2094 + 256 6 3: 2 1 3   Cell division protein FtsH (EC 3.4.24.-) locus|SAUSA300_0489, protein_id|YP_493198.1, gi|87161534, geneID|3914660
558 549786 550667 882 + 228     1: 10   33 kDa chaperonin HslO gene_name|hslO, locus|SAUSA300_0490, protein_id|YP_493199.1, gi|87161152, geneID|3914497

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Cell_division-ribosomal_stress_proteins_cluster OlgaV RNA binding protein, contains ribosomal protein S1 domain


  Protein Sequence

>fig|451515.3.peg.554 RNA binding protein, contains ribosomal protein S1 domain
MSIEVGNKLKGKVTGIKKFGAFVELPEGKSGLVHISEVADNYVENVEEHLSVGDEVDVKV
LSIADDGKISLSIKKAKDRPRRQHTSKPSHQKPVQKAEDFEKKLSNFLKDSEDKLTSIKR
QTESRRGGKGSRR

MD5 = bb419441b39151d097569efbd7e744b0


  DNA Sequence

>fig|451515.3.peg.554 RNA binding protein, contains ribosomal protein S1 domain
atgtcaatcgaagttggaaataagcttaaaggtaaagtcactggtattaaaaagtttggt
gcattcgtagaattacctgaaggaaaaagtggtttagttcacattagtgaagtcgcagat
aattatgttgaaaacgtagaagagcacctttctgttggtgatgaagtagacgtaaaagta
ttatctattgctgatgatggaaaaattagtctttcaattaagaaagctaaagaccgtcca
cgtagacaacatacgagtaaaccaagtcatcaaaaaccagtgcaaaaagccgaagatttt
gaaaagaaattaagcaatttcttaaaagatagtgaagataaattaacttcaatcaaacgt
caaacagaatctagacgcggtggcaaaggttcaagacgttaa


  DNA with Flanking Sequence

>fig|451515.3.peg.554 RNA binding protein, contains ribosomal protein S1 domain
gcaatgaaaaataaagtagaacatatagaaaatcagtacacgtcgcaagagaacaagaaa
aaacaacgtcaaaaaatgaaaatgcgtgttgttcgtaggcgtattacagtatttgcgggc
gtattacttgcgataattgttgttttatcaatcttgcttgttgtccaaaaacatcgcaat
gatattgatgcacaggagcgaaaagcgaaagaagcacagtttcaaaagcaacaaaatgaa
gaaattgcgttaaaagaaaagttgaataatctgaatgacaaagattacattgaaaaaatt
gcgcgtgatgattattacttaagcaacaaaggtgaagtgatttttaggttgccagaagac
aaagattcgtctagctcaaaatcttcgaaaaaataaatccaaattgattcaaaattatcc
gagtatagacattgtgaaaaaatccaaacaaggatataataagggaaaatcgaatcaaat
cgggaggatttatttaacatatgtcaatcgaagttggaaataagcttaaaggtaaagtca
ctggtattaaaaagtttggtgcattcgtagaattacctgaaggaaaaagtggtttagttc
acattagtgaagtcgcagataattatgttgaaaacgtagaagagcacctttctgttggtg
atgaagtagacgtaaaagtattatctattgctgatgatggaaaaattagtctttcaatta
agaaagctaaagaccgtccacgtagacaacatacgagtaaaccaagtcatcaaaaaccag
tgcaaaaagccgaagattttgaaaagaaattaagcaatttcttaaaagatagtgaagata
aattaacttcaatcaaacgtcaaacagaatctagacgcggtggcaaaggttcaagacgtt
aattaaaataaataaagactgcttcgataaggaatatatttagaatgatgcgtatcgaat
aatcgattgcagcgttagacaatctaagactgtttcttaaataaggagcagtctctttta
tttgtaatgatataactaagacttataccatttttgaaaattgtaaaagtgaggtgatgt
tatgcagttaaatagtaatggttggcatgttgatgaccatattgttgtcgctgtttctac
aggtattgatagtatgtgtttattgtatcaactactaaatgattataaagatagttatag
aaaactaacatgcttacatgtcaatcatggcgttaggtcagcttcaattgaggaagccag
atttttagaagcatactgcgaacgtcatcacatcgatttacatatcaaaaagttagattt
gtcgcatagtctcgaccgaaataacagcattcagaatgaagctcgaattaaacgttacga
atggtttgatgaaatgatgaat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003723       F:RNA binding
GO:0004654       F:polyribonucleotide nucleotidyltransferase a...
GO:0016740       F:transferase activity
cmr|NT01SA0508 Staphylococcus aureus N315     S1 RNA binding domain protein
cmr|NT02SA0502 Staphylococcus aureus Mu50     polyribonucleotide nucleotidyltransferase
cmr|NT03SA0514 Staphylococcus aureus MW2     general stress protein 13
cmr|NT05SA0427 Staphylococcus aureus NCTC 8325     RNA binding S1
cmr|NT09SA0462 Staphylococcus aureus subsp. aureus MSSA476     S1 RNA binding domain protein
cmr|SACOL0552 Staphylococcus aureus subsp. aureus COL     general stress protein 13
cmr|SAUSA300_0486 Staphylococcus aureus subsp. aureus USA300-FPR3757     polyribonucleotide nucleotidyltransferase
dbj|BAB41696.1 Staphylococcus aureus subsp. aureus N315     SA0466
dbj|BAB56670.1 Staphylococcus aureus subsp. aureus Mu50     polyribonucleotide nucleotidyltransferase
dbj|BAB94328.1 Staphylococcus aureus subsp. aureus MW2     MW0463
dbj|BAF66742.1 Staphylococcus aureus subsp. aureus str. Newman     polyribonucleotide nucleotidyltransferase
dbj|BAF77388.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
emb|CAG42240.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative RNA binding protein
fig|158878.1.peg.508 Staphylococcus aureus subsp. aureus Mu50 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|158878.14.peg.512 Staphylococcus aureus subsp. aureus Mu50 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|158879.1.peg.479 Staphylococcus aureus subsp. aureus N315 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|158879.11.peg.491 Staphylococcus aureus subsp. aureus N315 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|196620.1.peg.463 Staphylococcus aureus subsp. aureus MW2 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|196620.5.peg.491 Staphylococcus aureus subsp. aureus MW2 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|282459.1.peg.460 Staphylococcus aureus subsp. aureus MSSA476 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|282459.5.peg.486 Staphylococcus aureus subsp. aureus MSSA476 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|359786.13.peg.582 Staphylococcus aureus subsp. aureus JH9 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|359786.3.peg.2651 Staphylococcus aureus subsp. aureus JH9 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|359787.11.peg.572 Staphylococcus aureus subsp. aureus JH1 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|359787.3.peg.2214 Staphylococcus aureus subsp. aureus JH1 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|367830.3.peg.366 Staphylococcus aureus subsp. aureus USA300 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|418127.4.peg.474 Staphylococcus aureus subsp. aureus Mu3 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|418127.6.peg.510 Staphylococcus aureus subsp. aureus Mu3 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|426430.6.peg.472 Staphylococcus aureus subsp. aureus str. Newman FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|426430.8.peg.516 Staphylococcus aureus subsp. aureus str. Newman FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|450394.6.peg.2679 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|451516.9.peg.544 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|452948.4.peg.1701 Staphylococcus aureus 930918-3 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|455227.3.peg.2095 Staphylococcus aureus D30 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|505321.3.peg.687 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|546342.3.peg.1579 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|546343.3.peg.2361 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|548470.3.peg.2784 Staphylococcus aureus subsp. aureus MN8 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|548473.3.peg.2371 Staphylococcus aureus subsp. aureus TCH60 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|548474.3.peg.2401 Staphylococcus aureus subsp. aureus TCH130 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|548475.3.peg.2685 Staphylococcus aureus subsp. aureus TCH70 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|553565.3.peg.567 Staphylococcus aureus A5937 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|553567.3.peg.2307 Staphylococcus aureus A5948 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|553568.3.peg.330 Staphylococcus aureus A6224 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|553571.3.peg.1133 Staphylococcus aureus A6300 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|553573.3.peg.2327 Staphylococcus aureus A8115 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|553574.3.peg.2419 Staphylococcus aureus A8117 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|553577.3.peg.2520 Staphylococcus aureus A8796 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|553580.3.peg.2538 Staphylococcus aureus A8819 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|553581.3.peg.314 Staphylococcus aureus A9299 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|553583.3.peg.1983 Staphylococcus aureus A9635 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|553588.3.peg.1120 Staphylococcus aureus A9719 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|553590.4.peg.2415 Staphylococcus aureus A9754 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|553592.3.peg.357 Staphylococcus aureus A9763 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|553594.3.peg.2244 Staphylococcus aureus A9765 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|553596.3.peg.1133 Staphylococcus aureus A9781 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|553601.3.peg.2458 Staphylococcus aureus A10102 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|585143.3.peg.1015 Staphylococcus aureus subsp. aureus 55/2053 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|585144.3.peg.1026 Staphylococcus aureus subsp. aureus 58-424 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|585145.3.peg.1007 Staphylococcus aureus subsp. aureus 65-1322 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|585146.3.peg.1013 Staphylococcus aureus subsp. aureus 68-397 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|585147.3.peg.32 Staphylococcus aureus subsp. aureus A017934/97 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|585148.3.peg.31 Staphylococcus aureus subsp. aureus Btn1260 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|585149.6.peg.633 Staphylococcus aureus subsp. aureus C101 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|585150.3.peg.1056 Staphylococcus aureus subsp. aureus C160 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|585151.3.peg.123 Staphylococcus aureus subsp. aureus C427 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|585152.3.peg.421 Staphylococcus aureus subsp. aureus D139 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|585153.3.peg.1066 Staphylococcus aureus subsp. aureus E1410 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|585155.3.peg.1044 Staphylococcus aureus subsp. aureus H19 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|585156.3.peg.29 Staphylococcus aureus subsp. aureus M1015 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|585157.3.peg.151 Staphylococcus aureus subsp. aureus M809 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|585158.3.peg.1006 Staphylococcus aureus subsp. aureus M876 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|585159.3.peg.618 Staphylococcus aureus subsp. aureus M899 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|585160.3.peg.29 Staphylococcus aureus subsp. aureus WBG10049 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|585161.3.peg.366 Staphylococcus aureus subsp. aureus WW2703/97 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|585891.3.peg.512 Staphylococcus aureus subsp. aureus Mu50-omega FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|644279.4.peg.580 Staphylococcus aureus subsp. aureus 132 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|680649.3.peg.1513 Staphylococcus aureus subsp. aureus MR1 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|681288.4.peg.460 Staphylococcus aureus subsp. aureus ED98 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|703339.3.peg.488 Staphylococcus aureus 04-02981 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|762962.3.peg.2643 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|93061.3.peg.380 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|93061.5.peg.435 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|93062.19.peg.537 Staphylococcus aureus subsp. aureus COL FIG   RNA binding protein, contains ribosomal protein S1 domain
fig|93062.4.peg.1007 Staphylococcus aureus subsp. aureus COL FIG   RNA binding protein, contains ribosomal protein S1 domain
gb|AAW37664.1 Staphylococcus aureus subsp. aureus COL     general stress protein 13
gb|ABD20674.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     polyribonucleotide nucleotidyltransferase
gb|ABD29636.1 Staphylococcus aureus subsp. aureus NCTC 8325     S1 RNA binding domain protein
gb|ABQ48334.1 Staphylococcus aureus subsp. aureus JH9     RNA binding S1 domain protein
gb|ABR51401.1 Staphylococcus aureus subsp. aureus JH1     RNA binding S1 domain protein
gb|ABX28528.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_0502
gb|EEI97273.1 Staphylococcus aureus subsp. aureus MN8     S1 family RNA-binding protein
gb|EEJ60870.1 Staphylococcus aureus subsp. aureus TCH60     S1 family RNA-binding protein
gb|EES56881.1 Staphylococcus aureus subsp. aureus TCH70     S1 family RNA-binding protein
gb|EES94017.1 Staphylococcus aureus subsp. aureus USA300_TCH959     S1 family RNA-binding protein
gb|EES95532.1 Staphylococcus aureus subsp. aureus TCH130     S1 family RNA-binding protein
gb|EEV04767.1 Staphylococcus aureus subsp. aureus 55/2053     polyribonucleotide nucleotidyltransferase
gb|EEV07405.1 Staphylococcus aureus subsp. aureus 65-1322     polyribonucleotide nucleotidyltransferase
gb|EEV10034.1 Staphylococcus aureus subsp. aureus 68-397     conserved hypothetical protein
gb|EEV12623.1 Staphylococcus aureus subsp. aureus E1410     polyribonucleotide nucleotidyltransferase
gb|EEV15283.1 Staphylococcus aureus subsp. aureus M876     conserved hypothetical protein
gb|EEV26563.1 Staphylococcus aureus A9781     polyribonucleotide nucleotidyltransferase
gb|EEV65639.1 Staphylococcus aureus A9763     polyribonucleotide nucleotidyltransferase
gb|EEV67606.1 Staphylococcus aureus A9719     RNA binding S1 domain-containing protein
gb|EEV69360.1 Staphylococcus aureus A9635     conserved hypothetical protein
gb|EEV73651.1 Staphylococcus aureus A9299     RNA binding S1 domain-containing protein
gb|EEV78024.1 Staphylococcus aureus A6300     RNA binding S1 domain-containing protein
gb|EEV81576.1 Staphylococcus aureus A6224     S1 RNA binding domain-containing protein
gb|EEV82350.1 Staphylococcus aureus A5948     polyribonucleotide nucleotidyltransferase
gb|EEV86767.1 Staphylococcus aureus A5937     polyribonucleotide nucleotidyltransferase
gb|EEW44629.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1956
gb|EEW46511.1 Staphylococcus aureus D30     hypothetical protein SAD30_0221
gi|13700398 Staphylococcus aureus subsp. aureus N315 NCBI   SA0466
gi|14246276 Staphylococcus aureus subsp. aureus Mu50 NCBI   polyribonucleotide nucleotidyltransferase
gi|147740036 Staphylococcus aureus subsp. aureus JH9 NCBI   RNA binding S1 domain protein
gi|148266967 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0530
gi|149945465 Staphylococcus aureus subsp. aureus JH1 NCBI   RNA binding S1 domain protein
gi|150373482 Staphylococcus aureus subsp. aureus str. Newman NCBI   polyribonucleotide nucleotidyltransferase
gi|150393013 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_0543
gi|151220682 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0470
gi|156720971 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156978836 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0505
gi|15923498 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV0508
gi|15926185 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0466
gi|160367557 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0502
gi|161508748 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0502
gi|21203628 Staphylococcus aureus subsp. aureus MW2 NCBI   MW0463
gi|21282192 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW0463
gi|221138557 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_07923
gi|221142300 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_11807
gi|227247514 Staphylococcus aureus subsp. aureus MN8 NCBI   S1 family RNA-binding protein
gi|227556078 Staphylococcus aureus subsp. aureus MN8 NCBI   S1 family RNA-binding protein
gi|227851072 Staphylococcus aureus subsp. aureus TCH60 NCBI   S1 family RNA-binding protein
gi|227900605 Staphylococcus aureus subsp. aureus TCH60 NCBI   S1 family RNA-binding protein
gi|251804224 Staphylococcus aureus subsp. aureus TCH70 NCBI   S1 family RNA-binding protein
gi|251812236 Staphylococcus aureus subsp. aureus TCH70 NCBI   S1 family RNA-binding protein
gi|253315223 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_03490
gi|253725288 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   S1 family RNA-binding protein
gi|253726803 Staphylococcus aureus subsp. aureus TCH130 NCBI   S1 family RNA-binding protein
gi|253730976 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   S1 family RNA-binding protein
gi|253735243 Staphylococcus aureus subsp. aureus TCH130 NCBI   S1 family RNA-binding protein
gi|255005301 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_02500
gi|257272647 Staphylococcus aureus subsp. aureus 55/2053 NCBI   polyribonucleotide nucleotidyltransferase
gi|257275937 Staphylococcus aureus subsp. aureus 65-1322 NCBI   polyribonucleotide nucleotidyltransferase
gi|257279439 Staphylococcus aureus subsp. aureus 68-397 NCBI   conserved hypothetical protein
gi|257282490 Staphylococcus aureus subsp. aureus E1410 NCBI   polyribonucleotide nucleotidyltransferase
gi|257285166 Staphylococcus aureus subsp. aureus M876 NCBI   conserved hypothetical protein
gi|257424620 Staphylococcus aureus subsp. aureus 55/2053 NCBI   polyribonucleotide nucleotidyltransferase
gi|257427286 Staphylococcus aureus subsp. aureus 65-1322 NCBI   polyribonucleotide nucleotidyltransferase
gi|257429923 Staphylococcus aureus subsp. aureus 68-397 NCBI   conserved hypothetical protein
gi|257432625 Staphylococcus aureus subsp. aureus E1410 NCBI   polyribonucleotide nucleotidyltransferase
gi|257435529 Staphylococcus aureus subsp. aureus M876 NCBI   conserved hypothetical protein
gi|257788223 Staphylococcus aureus A9781 NCBI   polyribonucleotide nucleotidyltransferase
gi|257794251 Staphylococcus aureus A9781 NCBI   polyribonucleotide nucleotidyltransferase
gi|257841190 Staphylococcus aureus A9763 NCBI   polyribonucleotide nucleotidyltransferase
gi|257843193 Staphylococcus aureus A9719 NCBI   RNA binding S1 domain-containing protein
gi|257845325 Staphylococcus aureus A9635 NCBI   conserved hypothetical protein
gi|257849684 Staphylococcus aureus A9299 NCBI   RNA binding S1 domain-containing protein
gi|257855082 Staphylococcus aureus A6300 NCBI   RNA binding S1 domain-containing protein
gi|257858703 Staphylococcus aureus A6224 NCBI   S1 RNA binding domain-containing protein
gi|257859497 Staphylococcus aureus A5948 NCBI   polyribonucleotide nucleotidyltransferase
gi|257864012 Staphylococcus aureus A5937 NCBI   polyribonucleotide nucleotidyltransferase
gi|258407232 Staphylococcus aureus A9763 NCBI   polyribonucleotide nucleotidyltransferase
gi|258420801 Staphylococcus aureus A9719 NCBI   RNA binding S1 domain-containing protein
gi|258424456 Staphylococcus aureus A9635 NCBI   conserved hypothetical protein
gi|258429625 Staphylococcus aureus A9299 NCBI   RNA binding S1 domain-containing protein
gi|258446105 Staphylococcus aureus A6300 NCBI   RNA binding S1 domain-containing protein
gi|258448013 Staphylococcus aureus A6224 NCBI   S1 RNA binding domain-containing protein
gi|258452811 Staphylococcus aureus A5948 NCBI   polyribonucleotide nucleotidyltransferase
gi|258453841 Staphylococcus aureus A5937 NCBI   polyribonucleotide nucleotidyltransferase
gi|259159582 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1956
gi|259161928 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0221
gi|49243815 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative RNA binding protein
gi|49485372 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS0465
gi|57285570 Staphylococcus aureus subsp. aureus COL NCBI   general stress protein 13
gi|57651384 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0552
gi|87126160 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   polyribonucleotide nucleotidyltransferase
gi|87160186 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_0486
gi|87201826 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   S1 RNA binding domain protein
gi|88194268 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00483
img|637092082 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637099009 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637151327 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637156677 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637298207 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637887140 Staphylococcus aureus aureus USA300 IMG   polyribonucleotide nucleotidyltransferase( EC:2.7.7.8 )
img|637893138 Staphylococcus aureus aureus NCTC 8325 IMG   S1 RNA binding domain protein
img|639109595 Staphylococcus aureus aureus JH1 IMG   RNA binding S1
img|640564864 Staphylococcus aureus aureus JH9 IMG   RNA binding S1 domain protein
img|640778614 Staphylococcus aureus aureus JH1 IMG   RNA binding S1 domain protein
img|640794833 Staphylococcus aureus aureus Newman IMG   polyribonucleotide nucleotidyltransferase
img|640903231 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641308461 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
img|641772101 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_0486 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein (EC:2.7.7.8)
kegg|sac:SACOL0552 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_0470 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sah:SaurJH1_0543 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_0530 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sam:MW0463 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_00483 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS0465   KEGG   hypothetical protein
kegg|sau:SA0466   KEGG   hypothetical protein
kegg|sav:SAV0508   KEGG   hypothetical protein
kegg|saw:SAHV_0505 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_0502 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|NP_371032.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV0508
ref|NP_373718.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0466
ref|NP_645280.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW0463
ref|YP_001245910.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_0530
ref|YP_001315688.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_0543
ref|YP_001331504.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0470
ref|YP_001441095.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0505
ref|YP_001574407.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_0502
ref|YP_042593.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS0465
ref|YP_185440.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0552
ref|YP_493195.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_0486
ref|YP_499060.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00483
ref|ZP_03563359.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_07923
ref|ZP_03566793.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_11807
ref|ZP_03986125.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   S1 family RNA-binding protein
ref|ZP_04018410.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   S1 family RNA-binding protein
ref|ZP_04826709.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   S1 family RNA-binding protein
ref|ZP_04838436.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_03490
ref|ZP_04865141.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   S1 family RNA-binding protein
ref|ZP_04869408.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   S1 family RNA-binding protein
ref|ZP_05143902.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_02500
ref|ZP_05601048.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   polyribonucleotide nucleotidyltransferase
ref|ZP_05603687.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   polyribonucleotide nucleotidyltransferase
ref|ZP_05606309.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   conserved hypothetical protein
ref|ZP_05608987.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   polyribonucleotide nucleotidyltransferase
ref|ZP_05611579.1 Staphylococcus aureus subsp. aureus M876 RefSeq   conserved hypothetical protein
ref|ZP_05643230.1 Staphylococcus aureus A9781 RefSeq   polyribonucleotide nucleotidyltransferase
ref|ZP_05680377.1 Staphylococcus aureus A9763 RefSeq   polyribonucleotide nucleotidyltransferase
ref|ZP_05683737.1 Staphylococcus aureus A9719 RefSeq   RNA binding S1 domain-containing protein
ref|ZP_05687335.1 Staphylococcus aureus A9635 RefSeq   conserved hypothetical protein
ref|ZP_05688299.1 Staphylococcus aureus A9299 RefSeq   RNA binding S1 domain-containing protein
ref|ZP_05694266.1 Staphylococcus aureus A6300 RefSeq   RNA binding S1 domain-containing protein
ref|ZP_05696143.1 Staphylococcus aureus A6224 RefSeq   S1 RNA binding domain-containing protein
ref|ZP_05700806.1 Staphylococcus aureus A5948 RefSeq   polyribonucleotide nucleotidyltransferase
ref|ZP_05701814.1 Staphylococcus aureus A5937 RefSeq   polyribonucleotide nucleotidyltransferase
tr|A5IQ61 Staphylococcus aureus (strain JH9) TrEMBL   RNA binding S1 domain protein
tr|A6QEG0 Staphylococcus aureus (strain Newman) TrEMBL   Polyribonucleotide nucleotidyltransferase
tr|A6TYY3 Staphylococcus aureus (strain JH1) TrEMBL   RNA binding S1 domain protein
tr|A7WYR5 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|A8Z0Z7 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|C2GDH7 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   S1 family RNA-binding protein
tr|C2K1Y5 Staphylococcus aureus subsp. aureus MN8 TrEMBL   S1 family RNA-binding protein
tr|C5N2E9 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   S1 family RNA-binding protein
tr|C5Q5I9 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   S1 family RNA-binding protein
tr|C5QD65 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   S1 family RNA-binding protein
tr|Q2FJD3 Staphylococcus aureus (strain USA300) TrEMBL   Polyribonucleotide nucleotidyltransferase
tr|Q2G0R3 Staphylococcus aureus (strain NCTC 8325) TrEMBL   S1 RNA binding domain protein
tr|Q5HIG7 Staphylococcus aureus (strain COL) TrEMBL   General stress protein 13
tr|Q6GBY0 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative RNA binding protein
tr|Q7A1S0 Staphylococcus aureus (strain MW2) TrEMBL   MW0463 protein
tr|Q7A7A7 Staphylococcus aureus (strain N315) TrEMBL   SA0466 protein
tr|Q99W95 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Polyribonucleotide nucleotidyltransferase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
9 fig|451515.3.peg.549 Transcription-repair coupling factor
12 fig|451515.3.peg.550 Low temperature requirement B protein
13 fig|451515.3.peg.551 possible tetrapyrrole methyltransferase domain / Nucleoside triphosphate pyrophosphohydrolase MazG (EC 3.6.1.8)
20 fig|451515.3.peg.552 Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog)
6 fig|451515.3.peg.553 Cell division protein DivIC (FtsB), stabilizes FtsL against RasP cleavage
11 fig|451515.3.peg.555 tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)
9 fig|451515.3.peg.556 Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8)
6 fig|451515.3.peg.557 Cell division protein FtsH (EC 3.4.24.-)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search