The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.337: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: FIG01108255: hypothetical protein
Translate Function Assignments



Context on contig NC_007793 from base 322343 to 333927 (11585 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
332 322343 323293 951 +       1: 5 dlit(9171409) Glycyl-glycine endopeptidase LytM precursor (EC 3.4.24.75) gene_name|lytM, locus|SAUSA300_0270, protein_id|YP_492984.1, gi|87160448, geneID|3912951
333 324004 323345 660 - 51     3: 2 4 3   ABC transporter ATP-binding protein locus|SAUSA300_0271, protein_id|YP_492985.1, gi|87161084, geneID|3914270
334 324938 324018 921 - 13         FIG01107872: hypothetical protein locus|SAUSA300_0272, protein_id|YP_492986.1, gi|87160718, geneID|3912833
335 326101 324935 1167 - -4         FIG01108048: hypothetical protein locus|SAUSA300_0273, protein_id|YP_492987.1, gi|87161202, geneID|3914913
336 327692 326169 1524 - 67         FIG01108182: hypothetical protein locus|SAUSA300_0274, protein_id|YP_492988.1, gi|87160126, geneID|3912979
337 327963 328616 654 + 270         FIG01108255: hypothetical protein locus|SAUSA300_0275, protein_id|YP_492989.1, gi|87161065, geneID|3912775
338 328650 329237 588 + 33         FIG01108751: hypothetical protein locus|SAUSA300_0276, protein_id|YP_492990.1, gi|87160689, geneID|3914183
339 330273 329380 894 - 142         Secretory antigen precursor SsaA locus|SAUSA300_0277, protein_id|YP_492991.1, gi|87160169, geneID|3914521
340 330521 330814 294 + 247     1: 1 dlit(15657139) 6 kDa early secretory antigenic target ESAT-6 (EsxA) locus|SAUSA300_0278, protein_id|YP_492992.1, gi|87161298, geneID|3914717
341 330898 333927 3030 + 83     1: 1   Putative secretion accessory protein EsaA/YueB locus|SAUSA300_0279, protein_id|YP_492993.1, gi|87160703, geneID|3914197

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|451515.3.peg.337 FIG01108255: hypothetical protein
MELKVDDFVKNIKRPYLTVLGVFVVAVSLFFDAIMFFYAKLYDKLPMYLLVFMAFTAVIL
IMMYIQEKNENYKVEKRYVVRYLTLNVIVGYTLPLLFVSIYVFGVVGFGFDVFNYCLGII
LMLFISWLGLFLFYKNEFDSENPNPAVNAIAIIIKLFAFGGIFYISLIVPVTQQEEIFIG
LSIFINIIVDALLVRSYFNYALYKSIKKDIENEGKTM

MD5 = 7ea16a616c3e21b5d56450b0a91ffcc2


  DNA Sequence

>fig|451515.3.peg.337 FIG01108255: hypothetical protein
atggaattgaaagtcgatgattttgtaaagaatataaaaagaccatacttgactgtattg
ggagtatttgtagttgcagtttcattattttttgacgcgattatgtttttctacgctaaa
ctatatgataaattgcctatgtatttactggtgtttatggcctttacagctgtaattttg
attatgatgtacatacaagagaaaaatgaaaattacaaagttgaaaaaagatatgtggtt
agatatctcacacttaacgttattgtgggatatactttgccattgctttttgtatctatt
tacgtttttggtgtagtcggttttggatttgatgttttcaattattgtctaggtattatc
ttgatgttatttatttcttggttaggtttatttttattttataaaaacgaatttgatagt
gaaaatcctaatcctgcagttaatgccatagcaattattataaaattatttgcttttgga
ggaatattttatataagtctaatagttcctgtaacacagcaagaagagatttttataggg
ttaagtatattcatcaatataattgttgatgctcttcttgttaggtcatattttaattac
gcgttatataagagtattaagaaagatatcgaaaatgaaggtaagacaatgtaa


  DNA with Flanking Sequence

>fig|451515.3.peg.337 FIG01108255: hypothetical protein
aattctaatgaagataaaaacgaattatctttcatcttttcttggaacttcacttcattt
tcaaaacggtcattaaaataatctttatacatttttgctgtttgttgttcactttttagg
tatgtatttttcggtgtattagcaaaaaatgcataaactccccatgcgattccacctatt
aatagtaagacaataataataggaattataatttttaactttttagacattttgcttcct
cccaattatttatgagttaatcatatcagaacaatacattttattaaatggtttatttta
aattttgtttaaattaatagaattttagttataataatgtttaataagttattggaaatc
taataaactacaaaaaatagtttgattacataatgattcttgaaaaatgttggttaactt
aataatatgcatttttttggcgaagaagatttatttaacttataaaaatattgaagtaag
attggggagattatgaatttatggaattgaaagtcgatgattttgtaaagaatataaaaa
gaccatacttgactgtattgggagtatttgtagttgcagtttcattattttttgacgcga
ttatgtttttctacgctaaactatatgataaattgcctatgtatttactggtgtttatgg
cctttacagctgtaattttgattatgatgtacatacaagagaaaaatgaaaattacaaag
ttgaaaaaagatatgtggttagatatctcacacttaacgttattgtgggatatactttgc
cattgctttttgtatctatttacgtttttggtgtagtcggttttggatttgatgttttca
attattgtctaggtattatcttgatgttatttatttcttggttaggtttatttttatttt
ataaaaacgaatttgatagtgaaaatcctaatcctgcagttaatgccatagcaattatta
taaaattatttgcttttggaggaatattttatataagtctaatagttcctgtaacacagc
aagaagagatttttatagggttaagtatattcatcaatataattgttgatgctcttcttg
ttaggtcatattttaattacgcgttatataagagtattaagaaagatatcgaaaatgaag
gtaagacaatgtaaaggaaagacataaaaaataataggagtctaaccatgataattttta
ttttaataacaatatttgctatttattatatagctatgattgctagtttgtttaaaagtg
aaggtttttcaataataggtttaatattagatgttgttataatggggacattgatttttt
actattttataggcgctcgctttgttgatcatgatttaagcaactttttaatgtttatgg
atactggatcatatatttttatgtactttgcaattaagtgtttatgggtgaaacctaagg
tagtaaattatttgattgcaaaagaattgggtgaatctaaagaggtcattgaagagcagg
aattagatttacagacatcaaagataagaggtatctactttttcattatttcagtagtga
tgttaattatcactaaattaagaatgcaacctgagttacaggcagatgctatatcgatga
atcctgtatttatttttgttggtgttataatcat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA0226 Staphylococcus aureus NCTC 8325     membrane protein, putative
cmr|SACOL0268 Staphylococcus aureus subsp. aureus COL     hypothetical protein
cmr|SAUSA300_0275 Staphylococcus aureus subsp. aureus USA300-FPR3757     putative membrane protein
dbj|BAF66488.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.2204 Staphylococcus aureus subsp. aureus USA300 FIG   FIG01108255: hypothetical protein
fig|426430.6.peg.216 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01108255: hypothetical protein
fig|426430.8.peg.231 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01108255: hypothetical protein
fig|451516.9.peg.327 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   FIG01108255: hypothetical protein
fig|452948.4.peg.2261 Staphylococcus aureus 930918-3 FIG   FIG01108255: hypothetical protein
fig|455227.3.peg.2371 Staphylococcus aureus D30 FIG   FIG01108255: hypothetical protein
fig|553567.3.peg.2641 Staphylococcus aureus A5948 FIG   FIG01108255: hypothetical protein
fig|553590.4.peg.2630 Staphylococcus aureus A9754 FIG   FIG01108255: hypothetical protein
fig|553594.3.peg.2530 Staphylococcus aureus A9765 FIG   FIG01108255: hypothetical protein
fig|644279.4.peg.347 Staphylococcus aureus subsp. aureus 132 FIG   FIG01108255: hypothetical protein
fig|93061.3.peg.261 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01108255: hypothetical protein
fig|93061.5.peg.233 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01108255: hypothetical protein
fig|93062.19.peg.261 Staphylococcus aureus subsp. aureus COL FIG   FIG01108255: hypothetical protein
fig|93062.4.peg.730 Staphylococcus aureus subsp. aureus COL FIG   FIG01108255: hypothetical protein
gb|AAW38822.1 Staphylococcus aureus subsp. aureus COL     hypothetical protein SACOL0268
gb|ABD21553.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     putative membrane protein
gb|ABD29428.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX28325.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical membrane protein
gb|EEV82197.1 Staphylococcus aureus A5948     conserved hypothetical protein
gi|150373228 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151220428 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0216
gi|160367354 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical membrane protein
gi|161508545 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0294
gi|257859342 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258453132 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|57286728 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0268
gi|57652542 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0268
gi|87127039 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative membrane protein
gi|87161065 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_0275
gi|87201618 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194060 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00254
img|637151046 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637886930 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637892922 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640794576 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641308253 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical membrane protein
img|641771823 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical membrane protein
kegg|saa:SAUSA300_0275 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL0268 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_0216 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sao:SAOUHSC_00254 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_0294 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|YP_001331250.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0216
ref|YP_001574204.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_0294
ref|YP_185163.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0268
ref|YP_492989.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_0275
ref|YP_498848.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00254
ref|ZP_05701125.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QDQ6 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8Z0P6 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Hypothetical membrane protein
tr|Q2FJY9 Staphylococcus aureus (strain USA300) TrEMBL   Putative membrane protein
tr|Q2G192 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HJ94 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search