The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.309: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: CDP-ribitol:poly(ribitol phosphate) ribitol phosphotransferase
Translate Function Assignments



Context on contig NC_007793 from base 292945 to 305040 (12096 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
305 292945 293988 1044 +           Sorbitol dehydrogenase homologue (EC:1.1.1.14) locus|SAUSA300_0244, protein_id|YP_492958.1, gi|87161765, geneID|3913619
306 294516 295232 717 + 527     3: 1 2 3   Sugar-phosphate cytidylyltransferase locus|SAUSA300_0245, protein_id|YP_492959.1, gi|87161268, geneID|3915239
307 295225 296250 1026 + -8         Xylitol dehydrogenase locus|SAUSA300_0246, protein_id|YP_492960.1, gi|87161230, geneID|3914784
308 296272 297966 1695 + 21     1: 1   Putative polyribitolphosphotransferase locus|SAUSA300_0247, protein_id|YP_492961.1, gi|87161837, geneID|3913808
309 298394 299563 1170 + 427     1: 1   CDP-ribitol:poly(ribitol phosphate) ribitol phosphotransferase locus|SAUSA300_0248, protein_id|YP_492962.1, gi|87162248, geneID|3914873
310 299839 300555 717 + 275     3: 1 2 3   Sugar-phosphate cytidylyltransferase gene_name|ispD, locus|SAUSA300_0249, protein_id|YP_492963.1, gi|87160847, geneID|3913393
311 300548 301573 1026 + -8       dlit(15362865) Ribitol-5-phosphate 2-dehydrogenase (NADP(+)) (EC 1.1.1.405) locus|SAUSA300_0250, protein_id|YP_492964.1, gi|87161536, geneID|3914662
312 301595 303283 1689 + 21     1: 1   CDP-ribitol ribitolphosphotransferase (EC 2.7.8.14) locus|SAUSA300_0251, protein_id|YP_492965.1, gi|87162225, geneID|3914000
313 303316 305040 1725 + 32         Glycosyl transferase family protein, putative locus|SAUSA300_0252, protein_id|YP_492966.1, gi|87160407, geneID|3912852

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Teichoic_and_lipoteichoic_acids_biosynthesis OlgaV CDP-ribitol:poly(ribitol phosphate) ribitol phosphotransferase


  Protein Sequence

>fig|451515.3.peg.309 CDP-ribitol:poly(ribitol phosphate) ribitol phosphotransferase
MIKNTIKKLIEHSIYTTFKLLSKLPNKNLIYFESFHGKQYSDNPKALYEYLTEHSDAQLI
WGVKKGYEHIFQQHNVPYVTKFSMKWFLAMPRAKAWMINTRTPDWLYKSPRTTYLQTWHG
TPLKKIGLDISNVKMLGTNTQNYQDGFKKESQRWDYLVSPNPYSTSIFQNAFHVSRDKIL
ETGYPRNDKLSHKRNDTEYINGIKTRLNIPLDKKVIMYAPTWRDDEAIREGSYQFNVNFD
IEALRQALDDDYVILLRMHYLVVTRIDEHDDFVKDVSDYEDISDLYLISDALVTDYSSVM
FDFGVLKRPQIFYAYDLDKYGDELRGFYMDYKKELPGPIVENQTALIDALKQIDETANEY
IEARTVFYQKFCSLEDGQASQRICQTIFK

MD5 = b4ab6ed1bffc713485f3e7a3e182087f


  DNA Sequence

>fig|451515.3.peg.309 CDP-ribitol:poly(ribitol phosphate) ribitol phosphotransferase
atgattaaaaatacaattaaaaaattgatagaacatagtatatatacgacttttaaatta
ctatcaaaattgccaaacaagaatctaatttattttgaaagctttcatggtaaacaatac
agcgacaaccccaaagcattatatgaatacttaactgaacatagcgatgcccaattaata
tggggtgtgaaaaaaggatatgaacacatattccaacagcacaatgtaccatatgttaca
aagttttcaatgaaatggtttttagcgatgccaagagcgaaagcgtggatgattaacaca
cgtacaccagattggttatataaatcaccgcgaacgacgtacttacaaacatggcatggc
acgccattaaaaaagattggtttggatattagtaacgttaaaatgctaggaacaaatact
caaaattaccaagatggctttaaaaaagaaagccaacggtgggattatctagtgtcacct
aatccatattcgacatcgatatttcaaaatgcatttcatgttagtcgagataagattttg
gaaacaggttatccaagaaatgataaattatcacataaacgcaatgatactgaatatatt
aatggtattaagacaagattaaatattccattagataaaaaagtgattatgtacgcgcca
acttggcgtgacgatgaagcgattcgagaaggttcatatcaatttaatgttaactttgat
atagaagctttgcgtcaagcgctggatgatgattatgttattttattacgcatgcattat
ttagttgtgacacgtattgatgaacatgatgattttgtgaaagacgtttcagattatgaa
gacatttcggatttatacttaatcagcgatgcgttagttaccgactactcatctgtcatg
ttcgacttcggtgtattaaagcgtccgcaaattttctatgcatatgacttagataaatat
ggcgatgagcttagaggtttttacatggattataaaaaagagttgccaggtccaattgtt
gaaaatcaaacagcactcattgatgcattaaaacaaatcgatgagactgcaaatgagtat
attgaagcacgaacggtattttatcaaaaattctgttcattagaagatggacaagcgtca
caacgaatttgccaaacgatttttaagtga


  DNA with Flanking Sequence

>fig|451515.3.peg.309 CDP-ribitol:poly(ribitol phosphate) ribitol phosphotransferase
cttagataaacattttaaatatcaagatggtcgctcaagtgaacgtttagtcaaagattt
gtttagacgctaatgttggcatatattacttgccatgcaaatgagtcataaggcatagtt
ttcaagaagggttctgacaatgaagtgagcaacatgtcatgatgagaagcaggactatac
aatgagaataaccttttgatttttcatgcataaggcgattcaatcaaaagcaatcacctt
ccaactgaattgtcattttgtaaaataaaataatcgatccaatcgttatctaattcataa
atgtgtaaacacatacgttatgaatggataacgattttttgttatgttaaagtggtacat
taatcatgtatttcgtatgataattaacgacaagtgtaatggttaaatgtattttatgat
gaaatgctataataggcatggttacaatgagcttgctcatacatattaatataattacaa
aaacacgtcggaggtacgacatgattaaaaatacaattaaaaaattgatagaacatagta
tatatacgacttttaaattactatcaaaattgccaaacaagaatctaatttattttgaaa
gctttcatggtaaacaatacagcgacaaccccaaagcattatatgaatacttaactgaac
atagcgatgcccaattaatatggggtgtgaaaaaaggatatgaacacatattccaacagc
acaatgtaccatatgttacaaagttttcaatgaaatggtttttagcgatgccaagagcga
aagcgtggatgattaacacacgtacaccagattggttatataaatcaccgcgaacgacgt
acttacaaacatggcatggcacgccattaaaaaagattggtttggatattagtaacgtta
aaatgctaggaacaaatactcaaaattaccaagatggctttaaaaaagaaagccaacggt
gggattatctagtgtcacctaatccatattcgacatcgatatttcaaaatgcatttcatg
ttagtcgagataagattttggaaacaggttatccaagaaatgataaattatcacataaac
gcaatgatactgaatatattaatggtattaagacaagattaaatattccattagataaaa
aagtgattatgtacgcgccaacttggcgtgacgatgaagcgattcgagaaggttcatatc
aatttaatgttaactttgatatagaagctttgcgtcaagcgctggatgatgattatgtta
ttttattacgcatgcattatttagttgtgacacgtattgatgaacatgatgattttgtga
aagacgtttcagattatgaagacatttcggatttatacttaatcagcgatgcgttagtta
ccgactactcatctgtcatgttcgacttcggtgtattaaagcgtccgcaaattttctatg
catatgacttagataaatatggcgatgagcttagaggtttttacatggattataaaaaag
agttgccaggtccaattgttgaaaatcaaacagcactcattgatgcattaaaacaaatcg
atgagactgcaaatgagtatattgaagcacgaacggtattttatcaaaaattctgttcat
tagaagatggacaagcgtcacaacgaatttgccaaacgatttttaagtgataacttaaaa
acaataaaaaattataaattaattagttaagtgatataaataataaacgaaatgtttgct
tgtatgttattatttgtgtatgaaaacgtctgatataatgtaatataggtttaaacaaaa
tatgctaaaatataagcaaaatatgtataattttaagtaatacacagacatttagagttt
tgattttaaaatgagttttcaattggaaaatgcaacgaaatttaaataattaaatataga
tatagttgaatggaggaagtattttatgaaatacgctggtattctagctggaggtatagg
ctcaagaatgggtaacgtacctttacctaaacaatttttagatttagacaacaaaccgat
tttaatccatacattagaaaaatttattttaattaatgattttgaaaaaattattatcgc
gacgccacaacaatggatgacgcatacgaaagatacacttagaaaattcaaaatttctga
tgaaagaatt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0016020       C:membrane
GO:0019350       P:teichoic acid biosynthetic process
GO:0047355       F:CDP-glycerol glycerophosphotransferase acti...
cmr|NT05SA0198 Staphylococcus aureus NCTC 8325     CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase
cmr|SACOL0239 Staphylococcus aureus subsp. aureus COL     TagF domain protein
cmr|SAUSA300_0248 Staphylococcus aureus subsp. aureus USA300-FPR3757     putative teichoic acid biosynthesis protein F
fig|367830.3.peg.2022 Staphylococcus aureus subsp. aureus USA300 FIG   CDP-ribitol:poly(ribitol phosphate) ribitol phosphotransferase
fig|451516.9.peg.299 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   CDP-ribitol:poly(ribitol phosphate) ribitol phosphotransferase
fig|452948.4.peg.102 Staphylococcus aureus 930918-3 FIG   CDP-ribitol:poly(ribitol phosphate) ribitol phosphotransferase
fig|455227.3.peg.265 Staphylococcus aureus D30 FIG   CDP-ribitol:poly(ribitol phosphate) ribitol phosphotransferase
fig|553567.3.peg.1176 Staphylococcus aureus A5948 FIG   CDP-ribitol:poly(ribitol phosphate) ribitol phosphotransferase
fig|553590.4.peg.1252 Staphylococcus aureus A9754 FIG   CDP-ribitol:poly(ribitol phosphate) ribitol phosphotransferase
fig|553594.3.peg.2318 Staphylococcus aureus A9765 FIG   CDP-ribitol:poly(ribitol phosphate) ribitol phosphotransferase
fig|644279.4.peg.320 Staphylococcus aureus subsp. aureus 132 FIG   CDP-ribitol:poly(ribitol phosphate) ribitol phosphotransferase
fig|93061.3.peg.233 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   CDP-ribitol:poly(ribitol phosphate) ribitol phosphotransferase
fig|93061.5.peg.205 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   CDP-ribitol:poly(ribitol phosphate) ribitol phosphotransferase
fig|93062.19.peg.233 Staphylococcus aureus subsp. aureus COL FIG   CDP-ribitol:poly(ribitol phosphate) ribitol phosphotransferase
fig|93062.4.peg.702 Staphylococcus aureus subsp. aureus COL FIG   CDP-ribitol:poly(ribitol phosphate) ribitol phosphotransferase
gb|AAW38794.1 Staphylococcus aureus subsp. aureus COL     TagF domain protein
gb|ABD22736.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     putative teichoic acid biosynthesis protein F
gb|ABD29399.1 Staphylococcus aureus subsp. aureus NCTC 8325     teichoic acid biosynthesis protein F, putative
gb|ABX28296.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     CDP-glycerol glycerophosphotransferase
gb|EEV83554.1 Staphylococcus aureus A5948     TagF domain-containing protein
gb|EEW46026.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0685
gb|EEW48195.1 Staphylococcus aureus D30     hypothetical protein SAD30_1750
gi|160367325 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   CDP-glycerol glycerophosphotransferase
gi|161508516 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   CDP-glycerol glycerophosphotransferase
gi|257860732 Staphylococcus aureus A5948 NCBI   TagF domain-containing protein
gi|258451684 Staphylococcus aureus A5948 NCBI   TagF domain-containing protein
gi|259161007 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0685
gi|259163639 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1750
gi|57286700 Staphylococcus aureus subsp. aureus COL NCBI   TagF domain protein
gi|57652514 Staphylococcus aureus subsp. aureus COL NCBI   TagF domain-containing protein
gi|87128222 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative teichoic acid biosynthesis protein F
gi|87162248 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative teichoic acid biosynthesis protein F
gi|87201589 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   teichoic acid biosynthesis protein F, putative
gi|88194031 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   teichoic acid biosynthesis protein F, putative
img|637151018 Staphylococcus aureus aureus COL IMG   TagF domain protein
img|637886903 Staphylococcus aureus aureus USA300 IMG   putative teichoic acid biosynthesis protein F
img|637892893 Staphylococcus aureus aureus NCTC 8325 IMG   teichoic acid biosynthesis protein F, putative
img|641308224 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   CDP-glycerol glycerophosphotransferase( EC:2.7.8.12 )
img|641771968 Staphylococcus aureus aureus USA300_TCH959 IMG   CDP-glycerol glycerophosphotransferase
kegg|saa:SAUSA300_0248 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   putative teichoic acid biosynthesis protein F
kegg|sac:SACOL0239 Staphylococcus aureus subsp. aureus COL KEGG   TagF domain-containing protein
kegg|sao:SAOUHSC_00223 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   teichoic acid biosynthesis protein F, putative
kegg|sax:USA300HOU_0265 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   CDP-glycerol glycerophosphotransferase (EC:2.7.8.12)
ref|YP_001574175.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   CDP-glycerol glycerophosphotransferase
ref|YP_185135.1 Staphylococcus aureus subsp. aureus COL RefSeq   TagF domain-containing protein
ref|YP_492962.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   putative teichoic acid biosynthesis protein F
ref|YP_498819.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   teichoic acid biosynthesis protein F, putative
ref|ZP_05699710.1 Staphylococcus aureus A5948 RefSeq   TagF domain-containing protein
tr|A8Z0L7 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   CDP-glycerol glycerophosphotransferase
tr|Q2FK16 Staphylococcus aureus (strain USA300) TrEMBL   Putative teichoic acid biosynthesis protein F
tr|Q2G1C1 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Teichoic acid biosynthesis protein F, putative
tr|Q5HJC2 Staphylococcus aureus (strain COL) TrEMBL   TagF domain protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search