The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.2799: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter
Translate Function Assignments



Context on contig NC_007793 from base 2836811 to 2848668 (11858 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2793 2837824 2836811 1014 -       4: 12 1 3 10   Similar to histidinol-phosphate aminotransferase gene_name|hisC, locus|SAUSA300_2610, protein_id|YP_495244.1, gi|87161248, geneID|3913857
2794 2839090 2837840 1251 - 15     5: 11 9 1 5 3   Histidinol dehydrogenase (EC 1.1.1.23) gene_name|hisD, locus|SAUSA300_2611, protein_id|YP_495245.1, gi|87161366, geneID|3914765
2795 2839697 2839083 615 - -8     4: 9 1 5 3   ATP phosphoribosyltransferase (EC 2.4.2.17) gene_name|hisG, locus|SAUSA300_2612, protein_id|YP_495246.1, gi|87162093, geneID|3914636
2796 2840533 2839715 819 - 17     4: 9 1 5 3   ATP phosphoribosyltransferase regulatory subunit (EC 2.4.2.17) gene_name|hisZ, locus|SAUSA300_2613, protein_id|YP_495247.1, gi|87162290, geneID|3915330
2797 2841962 2840838 1125 - 304         FIG01107888: hypothetical protein locus|SAUSA300_2614, protein_id|YP_495248.1, gi|87160417, geneID|3913135
2798 2842577 2842080 498 - 117         FIG01108433: hypothetical protein locus|SAUSA300_2615, protein_id|YP_495249.1, gi|87161712, geneID|3915278
2799 2843457 2842624 834 - 46     5: 6 8 7 4 2   Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter locus|SAUSA300_2616, protein_id|YP_495250.1, gi|87162430, geneID|3915026
2800 2845166 2843454 1713 - -4     5: 6 8 7 4 2   Duplicated ATPase component MtsB of energizing module of methionine-regulated ECF transporter locus|SAUSA300_2617, protein_id|YP_495251.1, gi|87159923, geneID|3914969
2801 2845773 2845219 555 - 52     5: 6 8 7 4 2   Substrate-specific component MtsA of methionine-regulated ECF transporter locus|SAUSA300_2618, protein_id|YP_495252.1, gi|87160629, geneID|3915064
2802 2846650 2845802 849 - 28     2: 4 2   protein of unknown function DUF62 locus|SAUSA300_2619, protein_id|YP_495253.1, gi|87160530, geneID|3914010
2803 2847030 2847545 516 + 379         FIG01108092: hypothetical protein locus|SAUSA300_2620, protein_id|YP_495254.1, gi|87160363, geneID|3913237
2804 2848668 2847694 975 - 148       dlit(16019162)
dlit(17166853)
Lactonase Drp35 locus|SAUSA300_2621, protein_id|YP_495255.1, gi|87161933, geneID|3914593

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Methionine_Biosynthesis rodionov Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter
ECF_class_transporters rodionov Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter
DUF62 vcrecy Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter
AdoMetRepair_VDC vcrecy Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter
Methionine_biosynthesis_PanGenomes Acharya_Geeta_user Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter


  Protein Sequence

>fig|451515.3.peg.2799 Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter
MNQYNTIGFHPGNSRIHQLNATVKLLFLLVVSISAMVTYDTRYLILISASSILLVKYAHI
EWKQVRFVVKFILFFTILNIIAVYIFDPEYGVKIYNQRTELVNGIGRFTLTSQELFYLFN
LILKYISTVPLALIFLFTTNPSHFAASLNQLGVNYKISYAVSLALRYIPDIQETYFNISQ
AQQARGYDNSKKAKFTSRVKGIKRIVLPLIFSSIERIDTISTAMELRQFGQYKRRTWYVK
KQLKKDDYVVLCLTLILLMLVVTLFFLNNSRYFNPWH

MD5 = 561c89d44e1fcbc35c43f468ca802a83


  DNA Sequence

>fig|451515.3.peg.2799 Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter
atgaatcaatataatactataggttttcacccgggaaatagtcgtattcatcaattaaat
gcgactgttaaacttttattcttattagttgtttctatttctgcaatggtgacttatgac
acaagatatttaattttaattagtgcttcatctattttattggtcaaatatgctcatatt
gaatggaaacaagttcgctttgttgttaaattcattctgtttttcacaatattaaatatt
attgccgtgtacatatttgaccctgaatatggtgtgaagatttataatcagcgtacagag
ttagtcaatggtattggtcgatttacgctaacatcacaggaattattctatctttttaat
ctaatattaaaatatattagtacagttcctttagcgttaatatttttattcacaacgaat
ccgagtcattttgctgcaagtttaaatcagctaggtgtgaattataaaatcagttacgca
gtctcactagcattaaggtatattccagatattcaagaaacatattttaatatttcacaa
gcgcaacaagcaagaggatatgataattcgaaaaaagcaaaatttactagccgtgttaaa
ggtatcaaacgcattgtgttacctttaatattttctagtatcgaaagaattgacactatt
agtactgctatggagttaagacaattcggacagtataaaaggagaacctggtacgtcaaa
aaacaattaaaaaaagatgattatgttgttttgtgtttgacgttaatacttctgatgtta
gtagttacattattctttttaaataatagtcgatatttcaacccgtggcattag


  DNA with Flanking Sequence

>fig|451515.3.peg.2799 Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter
ttaagagcacgaggtatgaaagaatcagatataaagatacgagtagagaatgtgctcaaa
atatgcggactttatgcatttcggaattggccaattgcagctttaagctatggtcaaaaa
aagagggtcactatagcatctgttttagtcttaaatccggaaataatcatattggatgaa
ccgactgctggtcaagatttctatcattataatgagataatgtcatttttaattgaacta
aacagacaggggaagacgattattatgattacgcatgatatgcatttattgtctgagtat
agttcaagaacagttgtattatcaaaaggtcaagtcgttgctgataccacgccagtattg
gttttaaatgataaaaaaatctgtgagattgcatcattgagacaaacatcgctatttgaa
atggccgaatatatagggattagcgagccacagaaattagtacaattatttattaaccat
gataggaaggtgagacgccaatgaatcaatataatactataggttttcacccgggaaata
gtcgtattcatcaattaaatgcgactgttaaacttttattcttattagttgtttctattt
ctgcaatggtgacttatgacacaagatatttaattttaattagtgcttcatctattttat
tggtcaaatatgctcatattgaatggaaacaagttcgctttgttgttaaattcattctgt
ttttcacaatattaaatattattgccgtgtacatatttgaccctgaatatggtgtgaaga
tttataatcagcgtacagagttagtcaatggtattggtcgatttacgctaacatcacagg
aattattctatctttttaatctaatattaaaatatattagtacagttcctttagcgttaa
tatttttattcacaacgaatccgagtcattttgctgcaagtttaaatcagctaggtgtga
attataaaatcagttacgcagtctcactagcattaaggtatattccagatattcaagaaa
catattttaatatttcacaagcgcaacaagcaagaggatatgataattcgaaaaaagcaa
aatttactagccgtgttaaaggtatcaaacgcattgtgttacctttaatattttctagta
tcgaaagaattgacactattagtactgctatggagttaagacaattcggacagtataaaa
ggagaacctggtacgtcaaaaaacaattaaaaaaagatgattatgttgttttgtgtttga
cgttaatacttctgatgttagtagttacattattctttttaaataatagtcgatatttca
acccgtggcattagtattcatataaatagtctttaaatagaaataggagggagacattta
atgataaatactgaaagattaaatttaatgattccaagttcctcgcatttaattgaactt
tataatatttgtagtcatccacaagcaaatatatacactcccaaaggtttacataattcc
aaattagacacacaacggtggattgaaaaatggcgaaaccattggcaacaatatcaattt
ggttactttgtattggtaaaaaaaatagattgtagtgttattggtatttgtggatatgaa
tatcgacaattaaagcaagaaacagtattaaatttattttataaattacatccaagtttt
gaaggacaagggtacgcatgtgaggctattacagcaatcacaaattttgtgaattatatc
gatcaagaaacagtaaaagttatcaggacaaataagtgtaaccaacgttcaataaattta
gcagaaaggcttaaattcaagcgagacgatacta


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0006824       P:cobalt ion transport
GO:0009236       P:cobalamin biosynthetic process
GO:0015087       F:cobalt ion transmembrane transporter activity
cmr|NT05SA2698 Staphylococcus aureus NCTC 8325     cobalt transport family protein
cmr|SACOL2707 Staphylococcus aureus subsp. aureus COL     cobalt transport family protein
cmr|SAUSA300_2616 Staphylococcus aureus subsp. aureus USA300-FPR3757     cobalt transport family protein
dbj|BAF68853.1 Staphylococcus aureus subsp. aureus str. Newman     cobalt transport family protein
fig|367830.3.peg.2398 Staphylococcus aureus subsp. aureus USA300 FIG   Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter
fig|426430.6.peg.2491 Staphylococcus aureus subsp. aureus str. Newman FIG   Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter
fig|426430.8.peg.2796 Staphylococcus aureus subsp. aureus str. Newman FIG   Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter
fig|451516.9.peg.2793 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter
fig|452948.4.peg.1947 Staphylococcus aureus 930918-3 FIG   Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter
fig|553567.3.peg.888 Staphylococcus aureus A5948 FIG   Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter
fig|553590.4.peg.1855 Staphylococcus aureus A9754 FIG   Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter
fig|553594.3.peg.652 Staphylococcus aureus A9765 FIG   Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter
fig|644279.4.peg.56 Staphylococcus aureus subsp. aureus 132 FIG   Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter
fig|93061.3.peg.2859 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter
fig|93061.5.peg.2726 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter
fig|93062.19.peg.2632 Staphylococcus aureus subsp. aureus COL FIG   Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter
fig|93062.4.peg.2242 Staphylococcus aureus subsp. aureus COL FIG   Transmembrane component MtsC of energizing module of methionine-regulated ECF transporter
gb|AAW37355.1 Staphylococcus aureus subsp. aureus COL     cobalt transport family protein
gb|ABD22918.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     cobalt transport family protein
gb|ABD32004.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX30671.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     cobalt (Co2+) ABC superfamily ATP binding cassette transporter, membrane protein
gb|EEV83748.1 Staphylococcus aureus A5948     cobalt transporter
gb|EEW44440.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1025
gi|150375593 Staphylococcus aureus subsp. aureus str. Newman NCBI   cobalt transport family protein
gi|151222793 Staphylococcus aureus subsp. aureus str. Newman NCBI   cobalt transport family protein
gi|160369700 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   cobalt (Co2+) ABC superfamily ATP binding cassette transporter, membrane protein
gi|161510891 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   cobalt ABC transporter
gi|257860931 Staphylococcus aureus A5948 NCBI   cobalt transporter
gi|258451401 Staphylococcus aureus A5948 NCBI   cobalt transporter
gi|259159386 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1025
gi|57285261 Staphylococcus aureus subsp. aureus COL NCBI   cobalt transport family protein
gi|57651075 Staphylococcus aureus subsp. aureus COL NCBI   cobalt transport family protein
gi|87128404 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   cobalt transport family protein
gi|87162430 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   cobalt transport family protein
gi|87204194 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88196636 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_03018
img|637153446 Staphylococcus aureus aureus COL IMG   cobalt transport family protein
img|637889258 Staphylococcus aureus aureus USA300 IMG   cobalt transport family protein
img|637895616 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640797012 Staphylococcus aureus aureus Newman IMG   cobalt transport family protein
img|641310685 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   cobalt (Co2+) ABC superfamily ATP binding cassette transporter, membrane protein
img|641772182 Staphylococcus aureus aureus USA300_TCH959 IMG   cobalt (Co2+) ABC superfamily ATP binding cassette transporter, membrane protein
kegg|saa:SAUSA300_2616 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   cobalt transport family protein
kegg|sac:SACOL2707 Staphylococcus aureus subsp. aureus COL KEGG   cobalt transport family protein
kegg|sae:NWMN_2581 Staphylococcus aureus subsp. aureus Newman KEGG   cobalt transport family protein
kegg|sao:SAOUHSC_03018 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_2685 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   cobalt ABC transporter
ref|YP_001333615.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   cobalt transport family protein
ref|YP_001576550.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   cobalt ABC transporter
ref|YP_187493.1 Staphylococcus aureus subsp. aureus COL RefSeq   cobalt transport family protein
ref|YP_495250.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   cobalt transport family protein
ref|YP_501467.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_03018
ref|ZP_05699432.1 Staphylococcus aureus A5948 RefSeq   cobalt transporter
tr|A6QKH1 Staphylococcus aureus (strain Newman) TrEMBL   Cobalt transport family protein
tr|A8Z5I4 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Cobalt (Co2+) ABC superfamily ATP binding cassette transporter, membrane protein
tr|Q2FDH8 Staphylococcus aureus (strain USA300) TrEMBL   Cobalt transport family protein
tr|Q2FUT3 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HCL4 Staphylococcus aureus (strain COL) TrEMBL   Cobalt transport family protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search