The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.2648: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: Thioredoxin
Translate Function Assignments



Context on contig NC_007793 from base 2665406 to 2677118 (11713 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2642 2666305 2665406 900 -       4: 3 2 4 5   L-serine dehydratase, alpha subunit (EC 4.3.1.17) gene_name|sdaAA, locus|SAUSA300_2469, protein_id|YP_495103.1, gi|87162317, geneID|3913451
2643 2666999 2666319 681 - 13     4: 3 2 4 5   L-serine dehydratase, beta subunit (EC 4.3.1.17) gene_name|sdaAB, locus|SAUSA300_2470, protein_id|YP_495104.1, gi|87160329, geneID|3915404
2644 2668045 2667002 1044 - 2         Transcriptional regulator pfoR locus|SAUSA300_2471, protein_id|YP_495105.1, gi|87162136, geneID|3914683
2645 2668596 2668799 204 + 550         FIG01107948: hypothetical protein  
2646 2668991 2669917 927 + 191         FIG01108553: hypothetical protein locus|SAUSA300_2472, protein_id|YP_495106.1, gi|87160147, geneID|3913117
2647 2670967 2669999 969 - 81         Esterase/lipase (EC 3.1.1.-) locus|SAUSA300_2473, protein_id|YP_495107.1, gi|87161822, geneID|3914658
2648 2671444 2671100 345 - 132     4: 8 7 6 10   Thioredoxin locus|SAUSA300_2474, protein_id|YP_495108.1, gi|87162302, geneID|3913611
2649 2671896 2671486 411 - 41         FIG01107953: hypothetical protein locus|SAUSA300_2475, protein_id|YP_495109.1, gi|87161766, geneID|3913620
2650 2674342 2672276 2067 - 379         PTS system, glucose-specific IIC component / PTS system, glucose-specific IIB component (EC 2.7.1.69) / PTS system, glucose-specific IIA component gene_name|ptsG, locus|SAUSA300_2476, protein_id|YP_495110.1, gi|87160871, geneID|3914143
2651 2676382 2674643 1740 - 300     2: 9 1 dlit(12670989) Pyruvate oxidase [ubiquinone, cytochrome] (EC 1.2.2.2) @ Pyruvate oxidase, CidC gene_name|cidC, locus|SAUSA300_2477, protein_id|YP_495111.1, gi|87160334, geneID|3915109
2652 2677118 2676429 690 - 46     1: 1 dlit(12670989)
dlit(14617136)
CidA-associated membrane protein CidB gene_name|cidB, locus|SAUSA300_2478, protein_id|YP_495112.1, gi|87162027, geneID|3914284

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CBSS-315749.4.peg.3658 DanielaB Thioredoxin
ER_SOD Raterman_Erica_user Thioredoxin
Prolyl-tRNA_synthetase_associated_editing_enzymes howard.969 Thioredoxin
tRNA_synthetase_relationships howard.969 Thioredoxin


  Protein Sequence

>fig|451515.3.peg.2648 Thioredoxin
MVKQLNSVEAFREFIHQYPLAVVHVMRDQCSVCHAVLPQIEDLMQSYPNVPLAVINQSQV
EAIAGELNIFTVPVDLIFMNGKEMHRQGRFIDMQRFEHHLKQMNDSVNNDVDEH

MD5 = c158454734e74dd9a5cebb6de0453dfd


  DNA Sequence

>fig|451515.3.peg.2648 Thioredoxin
atggttaagcaattaaatagtgtcgaagcattccgtgaatttattcatcaatatccgtta
gcagttgtacatgtcatgcgcgatcagtgtagcgtgtgtcatgccgttttaccacaaatt
gaagacttgatgcaatcatatcccaatgtgccattagctgtgattaatcaaagtcaggtg
gaagctattgctggagaattaaatattttcactgtacctgtggatttaatttttatgaat
ggaaaagaaatgcatcgtcaagggcgttttatcgatatgcaacgttttgaacatcatctt
aagcaaatgaatgatagtgtaaataacgatgtcgatgagcattaa


  DNA with Flanking Sequence

>fig|451515.3.peg.2648 Thioredoxin
aattaacatgattttaaatctatttgtaagataaggagatttgtcattatgacaacagaa
ggtctattagttgcagagaaagaaatcgaagtgaatggttacgacattgatgcgatgggt
gtcgttagtaatatcgtttatattagatggttcgaagatttgagaacagcgtttattaat
cagcacatgaattactcaacaatgatcaatcaaggcatttcacctatacttatgaaaacg
gaagcagagtataaagtacctgtcacaatacatgacaaaccagtaggtcgtatttactta
gttaaagcaagcaagatgaaatgggtgtttcagtttgaaattgtgtccgcacatggcgtg
cattgtattggtacacagacaggcggtttttacagattgagtgataagaagataacctct
gtgccacaagtgtttcaagacattttagcaacaaaataatgacttcattttaaaatataa
aaagtaagaaggtgttcgaaatggttaagcaattaaatagtgtcgaagcattccgtgaat
ttattcatcaatatccgttagcagttgtacatgtcatgcgcgatcagtgtagcgtgtgtc
atgccgttttaccacaaattgaagacttgatgcaatcatatcccaatgtgccattagctg
tgattaatcaaagtcaggtggaagctattgctggagaattaaatattttcactgtacctg
tggatttaatttttatgaatggaaaagaaatgcatcgtcaagggcgttttatcgatatgc
aacgttttgaacatcatcttaagcaaatgaatgatagtgtaaataacgatgtcgatgagc
attaatatcgcaaatgattagcattgctaagattatgtagacatcataacttatttccca
gtaaatattggtagtaattagaatcagcatggtacagtagaactatagtagaaatcatca
aagaggagtgacgacaaatgcgtaaaaaatggtctacacttgcgtttggatttttagttg
cagcatacgcacatattagaattaaagaaaaacgcagtgtgaaaagttatatgttagaac
aaggtatacgattatctagagctaagcgtcgttttatgtataaagaagaagcgatgaaag
cattagaaaaaatggcgccacagacagcaggcgaatatgagggaaccaattatcagttta
agatgccagtaaaagtggataagcacttcggttcaaccgtttataccgttaacgataaac
aagataagcatcaacgcgttgtattatatgcacatggaggcgcatggttccaagacccac
tcaaaattcatttcgaatttattga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0045454       P:cell redox homeostasis
cmr|NT03SA2655 Staphylococcus aureus MW2     conserved hypothetical protein
cmr|NT05SA2551 Staphylococcus aureus NCTC 8325     thioredoxin
cmr|NT09SA2429 Staphylococcus aureus subsp. aureus MSSA476     thioredoxin
cmr|NT11SA2408 Staphylococcus aureus RF122     thioredoxin
cmr|SACOL2550 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_2474 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAB96322.1 Staphylococcus aureus subsp. aureus MW2     MW2457
dbj|BAF68707.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
emb|CAG44238.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   conserved hypothetical protein
emb|CAI82098.1 Staphylococcus aureus RF122 EMBL   conserved hypothetical protein
fig|196620.1.peg.2457 Staphylococcus aureus subsp. aureus MW2 FIG   Thioredoxin
fig|196620.5.peg.2539 Staphylococcus aureus subsp. aureus MW2 FIG   Thioredoxin
fig|273036.3.peg.2341 Staphylococcus aureus RF122 FIG   Thioredoxin
fig|273036.6.peg.2535 Staphylococcus aureus RF122 FIG   Thioredoxin
fig|282459.1.peg.2402 Staphylococcus aureus subsp. aureus MSSA476 FIG   Thioredoxin
fig|282459.5.peg.2524 Staphylococcus aureus subsp. aureus MSSA476 FIG   Thioredoxin
fig|367830.3.peg.1255 Staphylococcus aureus subsp. aureus USA300 FIG   Thioredoxin
fig|426430.6.peg.2355 Staphylococcus aureus subsp. aureus str. Newman FIG   Thioredoxin
fig|426430.8.peg.2644 Staphylococcus aureus subsp. aureus str. Newman FIG   Thioredoxin
fig|450394.6.peg.1537 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Thioredoxin
fig|451516.9.peg.2641 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Thioredoxin
fig|452948.4.peg.403 Staphylococcus aureus 930918-3 FIG   Thioredoxin
fig|546342.3.peg.968 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Thioredoxin
fig|546343.3.peg.1452 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Thioredoxin
fig|548474.3.peg.340 Staphylococcus aureus subsp. aureus TCH130 FIG   Thioredoxin
fig|548475.3.peg.1633 Staphylococcus aureus subsp. aureus TCH70 FIG   Thioredoxin
fig|553567.3.peg.962 Staphylococcus aureus A5948 FIG   Thioredoxin
fig|553590.4.peg.1705 Staphylococcus aureus A9754 FIG   Thioredoxin
fig|553594.3.peg.1532 Staphylococcus aureus A9765 FIG   Thioredoxin
fig|585152.3.peg.2527 Staphylococcus aureus subsp. aureus D139 FIG   Thioredoxin
fig|644279.4.peg.2686 Staphylococcus aureus subsp. aureus 132 FIG   Thioredoxin
fig|762962.3.peg.1969 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Thioredoxin
fig|93061.3.peg.2695 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Thioredoxin
fig|93061.5.peg.2574 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Thioredoxin
fig|93062.4.peg.2597 Staphylococcus aureus subsp. aureus COL FIG   Thioredoxin
gb|AAW37326.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD22790.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD31846.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX30512.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     possible thioredoxin
gb|EES94750.1 Staphylococcus aureus subsp. aureus USA300_TCH959     thioredoxin
gb|EEV83591.1 Staphylococcus aureus A5948     conserved hypothetical protein
gi|150375447 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151222647 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_2435
gi|160369541 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   possible thioredoxin
gi|161510732 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_2526
gi|21205629 Staphylococcus aureus subsp. aureus MW2 NCBI   MW2457
gi|21284186 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW2457
gi|221137977 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_04893
gi|221141417 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_07233
gi|253726021 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   thioredoxin
gi|253730212 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   thioredoxin
gi|257860771 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258451477 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|49245758 Staphylococcus aureus subsp. aureus MSSA476 NCBI   conserved hypothetical protein
gi|49487315 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS2422
gi|57285232 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57651046 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL2550
gi|82657650 Staphylococcus aureus RF122 NCBI   conserved hypothetical protein
gi|82752119 Staphylococcus aureus RF122 NCBI   hypothetical protein SAB2410c
gi|87128276 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87162302 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_2474
gi|87204036 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88196478 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02845
img|637153295 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637158693 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637300274 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637817384 Staphylococcus aureus RF122 IMG   hypothetical protein
img|637889116 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637895452 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640796866 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641310526 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   possible thioredoxin
img|641771206 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_2474 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sab:SAB2410c Staphylococcus aureus RF122 KEGG   hypothetical protein
kegg|sac:SACOL2550 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_2435 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sam:MW2457 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_02845 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS2422   KEGG   hypothetical protein
kegg|sax:USA300HOU_2526 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|NP_647274.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW2457
ref|YP_001333469.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_2435
ref|YP_001576391.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_2526
ref|YP_044536.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS2422
ref|YP_187342.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL2550
ref|YP_417860.1 Staphylococcus aureus RF122 RefSeq   hypothetical protein SAB2410c
ref|YP_495108.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_2474
ref|YP_501303.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02845
ref|ZP_03562779.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_04893
ref|ZP_03565910.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_07233
ref|ZP_04864377.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   thioredoxin
ref|ZP_05699505.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QK25 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8Z3D2 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Possible thioredoxin
tr|C5N085 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Thioredoxin
tr|Q2FDX0 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2FV89 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q2YWC3 Staphylococcus aureus (strain bovine RF122 / ET3-1) TrEMBL   Putative uncharacterized protein
tr|Q5HD15 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q6G6D8 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative uncharacterized protein
tr|Q8NUS4 Staphylococcus aureus (strain MW2) TrEMBL   MW2457 protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search