The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.2619: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: putative membrane protein
Translate Function Assignments



Context on contig NC_007793 from base 2636270 to 2649016 (12747 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2613 2637628 2636270 1359 -       1: 1   Gluconate permease, Bsu4004 homolog gene_name|gntP, locus|SAUSA300_2442, protein_id|YP_495076.1, gi|87160554, geneID|3913509
2614 2639298 2637745 1554 - 116     1: 1   Gluconokinase (EC 2.7.1.12) gene_name|gntK, locus|SAUSA300_2443, protein_id|YP_495077.1, gi|87162179, geneID|3913876
2615 2640002 2639322 681 - 23     1: 1   Gluconate operon transcriptional repressor GntR, FadR family gene_name|gntR, locus|SAUSA300_2444, protein_id|YP_495078.1, gi|87161583, geneID|3913652
2616 2640920 2640156 765 - 153     1: 7   Transcriptional regulator, MerR family locus|SAUSA300_2445, protein_id|YP_495079.1, gi|87161788, geneID|3914031
2617 2641777 2641085 693 - 164     1: 2 dlit(29326162) GTP pyrophosphokinase (EC 2.7.6.5) locus|SAUSA300_2446, protein_id|YP_495080.1, gi|87160878, geneID|3912955
2618 2642424 2642008 417 - 230         FIG01108416: hypothetical protein locus|SAUSA300_2447, protein_id|YP_495081.1, gi|87159987, geneID|3914415
2619 2644230 2642563 1668 - 138         putative membrane protein locus|SAUSA300_2448, protein_id|YP_495082.1, gi|87162352, geneID|3914201
2620 2646141 2644864 1278 - 633     2: 5 3   Uncharacterized MFS-type transporter locus|SAUSA300_2449, protein_id|YP_495083.1, gi|87160463, geneID|3913064
2621 2646688 2647299 612 + 546     1: 6   FIG00774911: hypothetical protein locus|SAUSA300_2450, protein_id|YP_495084.1, gi|87162438, geneID|3915034
2622 2648559 2647396 1164 - 96         major facilitator family transporter locus|SAUSA300_2451, protein_id|YP_495085.1, gi|87161394, geneID|3914164
2623 2649016 2648552 465 - -8     3: 4 8 9   Transcriptional regulator, MarR family locus|SAUSA300_2452, protein_id|YP_495086.1, gi|87160638, geneID|3915073

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|451515.3.peg.2619 putative membrane protein
MMLGTLTAKTPLVFGMTLLIVTVIPFYIFTALKIAGPSSTFFIVTFSLPINLPIAPEEAL
YRGFAILVGGILATMMVLITIVFSKNKAEEQAIQNDFKLISKLLHTYNDKSAFLQVAKTA
VDSFKASDKLLITSTSSNDKLSRRFQKLLLLHTSAQGIYSELLELNAKQIRPLPDELIEM
MDHIIAQLDNSEENVRYWRKEVTVTEEFQNLFNHILKIDEMVHANEARIAYEADMRKPLY
SKRIYQNLTLDSIVFRNTLRYTAIMMIAIFIALMFDFEKAYWIPLSAHTILLGTSTIHAI
ERGMARGLGTILGVLVLSVILLFSIPTPVAVILMGIAALFTEALVGANYAIAVVFITIQV
ILMNGLASQNLTINIAFPRVIDVAMGIVIAIIGLFVLGQRTASALLPNVMAEVVRKEATL
FHYLFSENQYKDDVYQKNTAMNLSVKLNNMTQVYNAANGELFSDKTLIQNYYPSLFALEE
ISFMLNRAMANEDRLTINEQLMGEYLAIFENIAKHFELNTELEIKILPDLPQYNYIQSAM
MNIQHNGFRERDKNV

MD5 = eb4689eea9e515700564270e405ce4b1


  DNA Sequence

>fig|451515.3.peg.2619 putative membrane protein
atgatgcttggtacgctaacagccaaaacgccactcgtttttggaatgacattattaatt
gttacggttataccattttatatatttactgccttaaaaatagctggaccgtcatcgaca
ttcttcattgtgacattcagtctacccattaacttacctatagctcccgaagaagcatta
tatagaggctttgcgattttagtaggcggtatacttgccactatgatggtgttaatcacg
atcgtattttctaaaaacaaagctgaagaacaagcaattcaaaatgattttaaactcata
tctaagttgttacacacttataatgataaatctgcttttttacaagtagcaaaaacagcg
gtggatagttttaaagcatctgataaattattaatcacttctacttcaagtaacgataaa
ttaagtagacgtttccaaaaattattattattacacacatctgcccaagggatttattct
gaactgttagagttgaacgctaaacaaattcgaccattgccagatgagttaattgaaatg
atggatcatatcattgcacaactagataatagtgaggaaaatgtaagatattggcgaaaa
gaagtgacagtaacagaggaatttcaaaatttattcaaccatatattgaaaattgatgaa
atggtgcatgcaaatgaagcgcgtattgcgtatgaagcagacatgcgaaaacctttatat
agtaaacgcatttatcaaaatttaacattagactctattgtttttagaaatacattgaga
tatacagcgattatgatgatagcgatatttattgcgttaatgtttgattttgaaaaagca
tactggataccgttatctgcacatacaatattactaggaacatcaactatacatgcaatc
gagagaggtatggcacgaggtttaggtactattttaggtgtgttagtactttcagtcata
ttgttgttttcaataccaacacctgttgcagtaattttaatgggcattgcagcattgttt
actgaagcattggtgggagcaaattatgcgattgcagtagtttttattacaatacaagtt
attttaatgaacggattagcatcacagaatttaacaattaacattgcgtttccaagagtt
attgacgttgcaatgggtattgtgattgcaatcataggtttatttgtccttggacaacgt
accgcatccgcattgcttcctaatgtaatggctgaagttgttcgtaaagaagcaacgctc
tttcattatttattttctgaaaatcaatataaagatgatgtgtatcagaaaaacacggct
atgaacctatctgtgaaattaaataacatgacgcaagtttataatgcagctaatggtgaa
ttatttagtgataagacattgattcaaaattattatcctagcttattcgcattagaagaa
attagctttatgttaaatagagccatggctaatgaagatagacttacaataaatgaacaa
ttaatgggcgagtatttagcaatatttgaaaacatcgctaagcatttcgaattaaataca
gaattagaaataaagatattaccagatttaccacagtataattatattcaatcagcaatg
atgaatattcaacacaatggttttcgtgagagagacaagaacgtttaa


  DNA with Flanking Sequence

>fig|451515.3.peg.2619 putative membrane protein
tttaaaacattagtcaggtaacgcttgtaaaagtacatataaattttaactagcgcaaag
gtgggcgaccaaaggttcaacgatgttaaataacattagaaattaattttaattggactt
taaaagtttttaaatttagataattgagcataaggtgttataatgacatatgttgcgtaa
ttaaaatttatagcaacaaattcattttaactatgctaataaaaagattatggaaatatt
ttgacaaggaaaggagaagtcgaaatgacatctttttgacatcactcataaaaatcaatc
gacttaacttagacttttataaaggtgtaagacagggactgttaatgattattcctgcaa
taatcggttacttatgtggtaatttccaatttggattattagttgcaaccggaacactag
cccatatttatgtttttaaaggtccgtcgcgatctaagctgcgaactgtaataatttgta
atttagcgtttgcaatatgtatgatgcttggtacgctaacagccaaaacgccactcgttt
ttggaatgacattattaattgttacggttataccattttatatatttactgccttaaaaa
tagctggaccgtcatcgacattcttcattgtgacattcagtctacccattaacttaccta
tagctcccgaagaagcattatatagaggctttgcgattttagtaggcggtatacttgcca
ctatgatggtgttaatcacgatcgtattttctaaaaacaaagctgaagaacaagcaattc
aaaatgattttaaactcatatctaagttgttacacacttataatgataaatctgcttttt
tacaagtagcaaaaacagcggtggatagttttaaagcatctgataaattattaatcactt
ctacttcaagtaacgataaattaagtagacgtttccaaaaattattattattacacacat
ctgcccaagggatttattctgaactgttagagttgaacgctaaacaaattcgaccattgc
cagatgagttaattgaaatgatggatcatatcattgcacaactagataatagtgaggaaa
atgtaagatattggcgaaaagaagtgacagtaacagaggaatttcaaaatttattcaacc
atatattgaaaattgatgaaatggtgcatgcaaatgaagcgcgtattgcgtatgaagcag
acatgcgaaaacctttatatagtaaacgcatttatcaaaatttaacattagactctattg
tttttagaaatacattgagatatacagcgattatgatgatagcgatatttattgcgttaa
tgtttgattttgaaaaagcatactggataccgttatctgcacatacaatattactaggaa
catcaactatacatgcaatcgagagaggtatggcacgaggtttaggtactattttaggtg
tgttagtactttcagtcatattgttgttttcaataccaacacctgttgcagtaattttaa
tgggcattgcagcattgtttactgaagcattggtgggagcaaattatgcgattgcagtag
tttttattacaatacaagttattttaatgaacggattagcatcacagaatttaacaatta
acattgcgtttccaagagttattgacgttgcaatgggtattgtgattgcaatcataggtt
tatttgtccttggacaacgtaccgcatccgcattgcttcctaatgtaatggctgaagttg
ttcgtaaagaagcaacgctctttcattatttattttctgaaaatcaatataaagatgatg
tgtatcagaaaaacacggctatgaacctatctgtgaaattaaataacatgacgcaagttt
ataatgcagctaatggtgaattatttagtgataagacattgattcaaaattattatccta
gcttattcgcattagaagaaattagctttatgttaaatagagccatggctaatgaagata
gacttacaataaatgaacaattaatgggcgagtatttagcaatatttgaaaacatcgcta
agcatttcgaattaaatacagaattagaaataaagatattaccagatttaccacagtata
attatattcaatcagcaatgatgaatattcaacacaatggttttcgtgagagagacaaga
acgtttaaaattaaatatttatcaggtcagactaacgtttgtctgaagttattatgacgg
gagtctaaaaaaatgtgtttaatatgtttcattttataattatggtggtatataacatga
attataacatattggaggttaaggaaatgccctttacaatgaaaggttaccccgaaaaat
ggaaagaatttgaagtaattaaacggcaaaaagcgatagaaattgcgaatgcaatgttaa
aagaaggatatcttgaaaaagatgttgttcctattgcggcgaaaaaagcgaaagattggt
atcgagcgttatcgaaagaagaaatcaaagcattagaagaagagaacttcgtacaattcc
atacagcaacaatggaaaaaacagaggtggatagtgaatatgcaacaactgataatgaag
aacatattcaagaacaatcaaatcaagataaatcgtactttgatagcgaatcaattggca
accaaagtggtggcgttcgacaaagaga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|426430.8.peg.2615 Staphylococcus aureus subsp. aureus str. Newman FIG   putative membrane protein
fig|452948.4.peg.1632 Staphylococcus aureus 930918-3 FIG   putative membrane protein
fig|546343.3.peg.2012 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   putative membrane protein
fig|553567.3.peg.2750 Staphylococcus aureus A5948 FIG   putative membrane protein
fig|553590.4.peg.1676 Staphylococcus aureus A9754 FIG   putative membrane protein
fig|553594.3.peg.1503 Staphylococcus aureus A9765 FIG   putative membrane protein
fig|644279.4.peg.2657 Staphylococcus aureus subsp. aureus 132 FIG   putative membrane protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search