The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.2524: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: Gamma-hemolysin component C
Translate Function Assignments



Context on contig NC_007793 from base 2538663 to 2550242 (11580 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2521 2539529 2538663 867 -       3: 7 10 9 dlit(30808698)
dlit(19226325)
Cation diffusion facilitator MntE locus|SAUSA300_2363, protein_id|YP_494998.1, gi|87161476, geneID|3914218
2522 2540281 2541591 1311 + 751         IgG-binding protein SBI gene_name|sbi, locus|SAUSA300_2364, protein_id|YP_494999.1, gi|87161897, geneID|3914408
2523 2542091 2543056 966 + 499         Gamma-hemolysin component A gene_name|hlgA, locus|SAUSA300_2365, protein_id|YP_495000.1, gi|87161385, geneID|3914155
2524 2543623 2544570 948 + 566       dlit(3075655)
dlit(8423103)
Gamma-hemolysin component C gene_name|hlgC, locus|SAUSA300_2366, protein_id|YP_495001.1, gi|87160644, geneID|3915079
2525 2544572 2545549 978 + 1       dlit(3075655)
dlit(8423103)
Cytolytic pore-forming protein F component => Gamma-hemolysin HlgB gene_name|hlgB, locus|SAUSA300_2367, protein_id|YP_495002.1, gi|87160716, geneID|3912831
2526 2546068 2545601 468 - 51         FIG01108016: hypothetical protein locus|SAUSA300_2368, protein_id|YP_495003.1, gi|87159932, geneID|3914978
2527 2546771 2546079 693 - 10     5: 2 3 4 5 1   Pimeloyl-CoA synthase (EC 6.2.1.14) locus|SAUSA300_2369, protein_id|YP_495004.1, gi|87162102, geneID|3913096
2528 2547897 2546782 1116 - 10     6: 6 2 3 4 5 1   8-amino-7-oxononanoate synthase (EC 2.3.1.47) locus|SAUSA300_2370, protein_id|YP_495005.1, gi|87161361, geneID|3914760
2529 2548882 2547875 1008 - -23     8: 6 2 11 3 4 5 1 8   Biotin synthase (EC 2.8.1.6) gene_name|bioB, locus|SAUSA300_2371, protein_id|YP_495006.1, gi|87160930, geneID|3914368
2530 2550242 2548884 1359 - 1     6: 6 2 3 4 5 1   Adenosylmethionine-8-amino-7-oxononanoate aminotransferase (EC 2.6.1.62) gene_name|bioA, locus|SAUSA300_2372, protein_id|YP_495007.1, gi|87160246, geneID|3915137

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|451515.3.peg.2524 Gamma-hemolysin component C
MLKNKILTTTLSVSLLAPLANPLLENAKAANDTEDIGKGSDIEIIKRTEDKTSNKWGVTQ
NIQFDFVKDKKYNKDALILKMQGFISSRTTYYNYKKTNHVKAMRWPFQYNIGLKTNDKYV
SLINYLPKNKIESTNVSQTLGYNIGGNFQSAPSLGGNGSFNYSKSISYTQQNYVSEVEQQ
NSKSVLWGVKANSFATESGQKSAFDSDLFVGYKPHSKDPRDYFVPDSELPPLVQSGFNPS
FIATVSHEKGSSDTSEFEITYGRNMDVTHAIKRSTHYGNSYLDGHRVHNAFVNRNYTVKY
EVNWKTHEIKVKGQN

MD5 = 02fa1b691797516759b704fcb456c14b


  DNA Sequence

>fig|451515.3.peg.2524 Gamma-hemolysin component C
atgcttaaaaataaaatattaactacaactttatctgtgagcttacttgcccctcttgcc
aatccgttattagaaaatgctaaagctgctaacgatactgaagacatcggtaaaggaagc
gatatagaaattatcaaaaggacagaagataaaacaagtaataaatggggcgtgactcaa
aatattcaatttgattttgtaaaggataaaaaatataacaaagatgctttgatattaaag
atgcaaggattcattagctctagaacaacatattacaactataaaaaaactaatcatgtt
aaagctatgcgatggccattccaatataatattggtttaaaaacaaatgataaatatgtt
tctttaattaattatttacctaaaaataaaattgaatctacaaacgtgagtcagacatta
ggatacaatatcggtggtaatttccaatcagccccatcactcggtggtaatggatcattt
aactattctaaatcgattagctatacacaacaaaattatgtaagtgaagtagaacaacaa
aactcaaaaagtgttttatggggcgtcaaagcgaattcattcgccactgaatcaggtcaa
aaatcagcctttgatagcgatttatttgtaggctacaaacctcatagtaaagatcctaga
gattatttcgttccagacagtgagttaccacctcttgtacaaagtggatttaacccttca
tttatcgccacagtatctcatgaaaaaggttcaagcgatacaagcgaatttgaaattact
tacggaagaaacatggatgtcactcatgccattaaaagatcaacgcattatggcaacagt
tatttagacggacatagagtccataatgcatttgtaaatagaaactatactgtgaaatac
gaggtcaattggaagactcatgaaatcaaggtgaaaggacagaattga


  DNA with Flanking Sequence

>fig|451515.3.peg.2524 Gamma-hemolysin component C
aatcagccttataacattaaattattttatcgtacattaaatttaataataacaactgat
ttttataagaataaagtatcgaaccatagtagatacacaaataatacaaatgaaacaatt
taacttgaaagcttaaataaatattatcaagttaataaacaattaatttttagatggatt
catcaaaaatcgtaaaaagcacaatttgtattttacaaacattaattaaaaaagaaagca
agacattcgtgcaatcggttaccttaaattgtttacaactgtcaacaataccaaggtttt
attaactatatttctcacaaaattagcttttagcattccaaacaaaaaaggttaaatcga
acggaattatggcatttttaacttaattgtaaaaaaagttgataatggtcaattgttaat
gaacagttaattataataacgcccaaaatatattattatttaattaagttaaataaaatt
atagaaataaagtgaaacttatgcttaaaaataaaatattaactacaactttatctgtga
gcttacttgcccctcttgccaatccgttattagaaaatgctaaagctgctaacgatactg
aagacatcggtaaaggaagcgatatagaaattatcaaaaggacagaagataaaacaagta
ataaatggggcgtgactcaaaatattcaatttgattttgtaaaggataaaaaatataaca
aagatgctttgatattaaagatgcaaggattcattagctctagaacaacatattacaact
ataaaaaaactaatcatgttaaagctatgcgatggccattccaatataatattggtttaa
aaacaaatgataaatatgtttctttaattaattatttacctaaaaataaaattgaatcta
caaacgtgagtcagacattaggatacaatatcggtggtaatttccaatcagccccatcac
tcggtggtaatggatcatttaactattctaaatcgattagctatacacaacaaaattatg
taagtgaagtagaacaacaaaactcaaaaagtgttttatggggcgtcaaagcgaattcat
tcgccactgaatcaggtcaaaaatcagcctttgatagcgatttatttgtaggctacaaac
ctcatagtaaagatcctagagattatttcgttccagacagtgagttaccacctcttgtac
aaagtggatttaacccttcatttatcgccacagtatctcatgaaaaaggttcaagcgata
caagcgaatttgaaattacttacggaagaaacatggatgtcactcatgccattaaaagat
caacgcattatggcaacagttatttagacggacatagagtccataatgcatttgtaaata
gaaactatactgtgaaatacgaggtcaattggaagactcatgaaatcaaggtgaaaggac
agaattgatatgaaaatgaataaattagtcaaatcatccgttgctacatctatggcatta
ttattactttctggtactgctaatgctgaaggtaaaataacaccagtcagcgtaaaaaaa
gtcgatgacaaagttactttatacaaaacaacagccacagcagattctgataaatttaaa
atttcacagattttaacatttaatttcatcaaagataaaagttatgataaagatacttta
gtacttaaagctactgggaatattaactcaggctttgtgaaacctaatcctaatgactat
gacttttcaaaattatattggggagctaaatacaatgtatctataagctcacaatctaat
gattcagtaaacgtcgttgattatgcaccaaaaaatcaaaatgaagagtttcaagttcaa
aatactttaggctatacatttggtggtgacattagtatctctaatggtttatctggtgga
cttaatggaaatacagctttttctgaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005576       C:extracellular region
GO:0009405       P:pathogenesis
GO:0019835       P:cytolysis
GO:0019836       P:hemolysis by symbiont of host erythrocytes
GO:0051715       P:cytolysis of cells of another organism
cmr|NT05SA2440 Staphylococcus aureus NCTC 8325     gamma-hemolysin component C
cmr|SAUSA300_2366 Staphylococcus aureus subsp. aureus USA300-FPR3757     gamma-hemolysin component C
dbj|BAF68591.1 Staphylococcus aureus subsp. aureus str. Newman     gamma-hemolysin component C
fig|367830.3.peg.517 Staphylococcus aureus subsp. aureus USA300 FIG   Gamma-hemolysin component C
fig|426430.6.peg.2247 Staphylococcus aureus subsp. aureus str. Newman FIG   Gamma-hemolysin component C
fig|426430.8.peg.2523 Staphylococcus aureus subsp. aureus str. Newman FIG   Gamma-hemolysin component C
fig|451516.9.peg.2514 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Gamma-hemolysin component C
fig|452948.4.peg.531 Staphylococcus aureus 930918-3 FIG   Gamma-hemolysin component C
fig|455227.3.peg.788 Staphylococcus aureus D30 FIG   Gamma-hemolysin component C
fig|546342.3.peg.1527 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Gamma-hemolysin component C
fig|546343.3.peg.1331 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Gamma-hemolysin component C
fig|553567.3.peg.760 Staphylococcus aureus A5948 FIG   Gamma-hemolysin component C
fig|553590.4.peg.1027 Staphylococcus aureus A9754 FIG   Gamma-hemolysin component C
fig|553594.3.peg.378 Staphylococcus aureus A9765 FIG   Gamma-hemolysin component C
fig|644279.4.peg.2565 Staphylococcus aureus subsp. aureus 132 FIG   Gamma-hemolysin component C
fig|93061.3.peg.2563 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Gamma-hemolysin component C
fig|93061.5.peg.2453 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Gamma-hemolysin component C
gb|AAA26638.1 Staphylococcus aureus     gamma-hemolysin component C
gb|ABD21132.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     gamma-hemolysin component C
gb|ABD31717.1 Staphylococcus aureus subsp. aureus NCTC 8325     leukocidin s subunit precursor, putative
gb|ABX30394.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     gamma hemolysin component C
gb|EEV83881.1 Staphylococcus aureus A5948     gamma-hemolysin component C
gi|150375331 Staphylococcus aureus subsp. aureus str. Newman NCBI   gamma-hemolysin component C
gi|151222531 Staphylococcus aureus subsp. aureus str. Newman NCBI   gamma-hemolysin component C
gi|15214040 organism not parsed/found in ncbi nr NCBI   RecName: Full=Gamma-hemolysin component C; AltName: Full=H-gamma-1; AltName: Full=H-gamma-I; Flags: Precursor
gi|160369423 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   gamma hemolysin component C
gi|161510614 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   gamma hemolysin component C
gi|221138504 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   gamma hemolysin component C
gi|221141301 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   gamma hemolysin component C
gi|257861066 Staphylococcus aureus A5948 NCBI   gamma-hemolysin component C
gi|258451274 Staphylococcus aureus A5948 NCBI   gamma-hemolysin component C
gi|295155 Staphylococcus aureus NCBI   gamma-hemolysin component C
gi|87126618 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   gamma-hemolysin component C
gi|87160644 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   gamma-hemolysin component C
gi|87203907 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   leukocidin s subunit precursor, putative
gi|88196349 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   leukocidin s subunit precursor, putative
img|637889009 Staphylococcus aureus aureus USA300 IMG   gamma-hemolysin component C
img|637895320 Staphylococcus aureus aureus NCTC 8325 IMG   leukocidin s subunit precursor, putative
img|640796750 Staphylococcus aureus aureus Newman IMG   gamma-hemolysin component C
img|641310408 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   gamma hemolysin component C
img|641771597 Staphylococcus aureus aureus USA300_TCH959 IMG   gamma hemolysin component C
kegg|saa:SAUSA300_2366 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   gamma-hemolysin component C
kegg|sae:NWMN_2319 Staphylococcus aureus subsp. aureus Newman KEGG   gamma-hemolysin component C
kegg|sao:SAOUHSC_02709 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   leukocidin S subunit precursor, putative
kegg|sax:USA300HOU_2404 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   gamma hemolysin component C
ref|YP_001333353.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   gamma-hemolysin component C
ref|YP_001576273.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   gamma hemolysin component C
ref|YP_495001.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   gamma-hemolysin component C
ref|YP_501171.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   leukocidin s subunit precursor, putative
ref|ZP_03563306.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   gamma hemolysin component C
ref|ZP_03565794.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   gamma hemolysin component C
ref|ZP_05699307.1 Staphylococcus aureus A5948 RefSeq   gamma-hemolysin component C
sp|HLGC_STAAU organism not parsed/found in ncbi nr SwissProt   RecName: Full=Gamma-hemolysin component C; AltName: Full=H-gamma-1; AltName: Full=H-gamma-I; Flags: Precursor
sp|Q07227 Staphylococcus aureus SwissProt   Gamma-hemolysin component C precursor
tr|A6QJQ9 Staphylococcus aureus (strain Newman) TrEMBL   Gamma-hemolysin component C
tr|A8YYH0 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Gamma hemolysin component C
tr|Q2FE77 Staphylococcus aureus (strain USA300) TrEMBL   Gamma-hemolysin component C
tr|Q2FVK2 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Leukocidin s subunit, putative


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(3075655);Claudia
evidence_code dlit(8423103);Claudia


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search