The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.2458: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: Teicoplanin resistance associated membrane protein TcaA
Translate Function Assignments



Context on contig NC_007793 from base 2469753 to 2481564 (11812 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2454 2471684 2469753 1932 -       1: 2   Membrane component of multidrug resistance system locus|SAUSA300_2298, protein_id|YP_494933.1, gi|87161734, geneID|3913020
2455 2472344 2471697 648 - 12     1: 2   Multidrug resistance protein [function not yet clear] locus|SAUSA300_2299, protein_id|YP_494934.1, gi|87160414, geneID|3913132
2456 2472465 2473016 552 + 120     1: 2   TetR family regulatory protein of MDR cluster locus|SAUSA300_2300, protein_id|YP_494935.1, gi|87162322, geneID|3913456
2457 2474454 2473246 1209 - 229     1: 1 dlit(11042376) Teicoplanin resistance transporter, TcaB family => TcaB gene_name|tcaB, locus|SAUSA300_2301, protein_id|YP_494936.1, gi|87161925, geneID|3914585
2458 2476105 2474723 1383 - 268     1: 1   Teicoplanin resistance associated membrane protein TcaA gene_name|tcaA, locus|SAUSA300_2302, protein_id|YP_494937.1, gi|87161173, geneID|3914747
2459 2476800 2476345 456 - 239     2: 1 5 dlit(11042376)
dlit(15060048)
Teicoplanin-resistance associated HTH-type transcriptional regulator TcaR gene_name|tcaR, locus|SAUSA300_2303, protein_id|YP_494938.1, gi|87159885, geneID|3914106
2460 2476995 2477963 969 + 194         Integral membrane protein locus|SAUSA300_2304, protein_id|YP_494939.1, gi|87162083, geneID|3914626
2461 2478538 2478894 357 + 574         truncated transposase locus|SAUSA300_2305, protein_id|YP_494940.1, gi|87161359, geneID|3912876
2462 2479699 2479034 666 - 139     2: 3 4   Heme efflux system ATPase HrtA locus|SAUSA300_2306, protein_id|YP_494941.1, gi|87160988, geneID|3913320
2463 2480754 2479699 1056 - -1     2: 3 4 dlit(16933993) Heme efflux system permease HrtB locus|SAUSA300_2307, protein_id|YP_494942.1, gi|87161438, geneID|3914111
2464 2480890 2481564 675 + 135     1: 3   Two-component response regulator colocalized with HrtAB transporter locus|SAUSA300_2308, protein_id|YP_494943.1, gi|87161981, geneID|3914878

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Teicoplanin-resistance_in_Staphylococcus SvetaG Teicoplanin resistance associated membrane protein TcaA


  Protein Sequence

>fig|451515.3.peg.2458 Teicoplanin resistance associated membrane protein TcaA
MKSCPKCGQQAQDDVQICTQCGHKFDSRQALYRKSTDEDIQTNNIKMRKMVPWAIGFFIL
ILIIILFFLLRNFNSPEAQTKILVNAIENNDKQKVATLLSTKDNKVDSEEAKVYINYIKD
EVGLKQFVSDLKNTVHKLNKSKTSVASYIQTRSGQNILRVSKNGTRYIFFDNMSFTAPTK
QPIVKPKEKTKYEFKSGGKKKMVIAEANKVTPIGNFIPGTYRIPAMKSTENGDFAGHLKF
DFRQSNSETVDVTEDFEEANISVTLKGDTKLNDSSKKVTINDHEMAFSSSKTYGPYPQNK
DITISASGKAKDKTFTTQTKTIKASDLKYNTEITLNFDSEDIEDYVEKKEKEENSLKNKL
IEFFAGYSLANNAAFNQSDFDFVSSYIKKGSSFYDDVKKRVSKGSLMMISSPQIIDAEKH
GDKITATVRLINENGKQVDKEYELEQGSQDRLQLIKTSEK

MD5 = 388b2b548d47ab969df7054f23e27a19


  DNA Sequence

>fig|451515.3.peg.2458 Teicoplanin resistance associated membrane protein TcaA
atgaaatcttgcccgaagtgcggacaacaagcacaagatgatgtacagatatgtacacaa
tgtggacataaatttgatagtcgtcaagcattatatagaaagtcaaccgatgaagatata
caaactaataacatcaagatgagaaaaatggtgccttgggcaattggttttttcatttta
atcttaattattatattgttctttttactaagaaacttcaattcacctgaagcgcaaact
aaaatattagtgaatgcgattgagaataatgataaacaaaaagtagcaacattattaagt
actaaagataataaagtagattctgaagaagcaaaagtatacattaactatatcaaagat
gaagttgggcttaagcaatttgtcagcgaccttaaaaatacggtacataaattgaataag
agtaagaccagcgtagcttcttatattcaaaccagatctggtcaaaatatattacgtgta
agtaaaaatggcacacgttatatctttttcgataatatgagctttactgcacctaccaag
caaccaattgttaaaccgaaagaaaaaacaaaatatgagtttaaatctggtggtaagaaa
aagatggttatagctgaagcaaataaagtgacgccaataggtaattttataccggggaca
tatagaattccagctatgaaatcaactgagaacggtgattttgcaggccatttaaaattt
gattttagacaaagtaattctgaaacggtagatgttactgaagattttgaagaagcaaat
atatctgtaactttaaaaggcgatacaaaattaaatgatagttctaaaaaagtaactata
aatgaccatgaaatggcattttcaagttccaaaacgtatggtccatatccacaaaataaa
gatattaccatttcagcttcaggtaaagcgaaagataaaacatttacaacacagacgaag
acgattaaagctagcgatttaaaatacaatacagagataactttgaattttgacagtgaa
gatatcgaagactatgttgaaaagaaagaaaaagaagaaaacagcttgaagaacaaattg
atagaattctttgctggatattctttagcgaataatgctgcgtttaatcagtcggatttt
gattttgtatcatcatatataaaaaaaggatcatctttttatgatgatgtaaagaagcgt
gtatctaaaggaagtttaatgatgattagttcaccacaaattatagatgctgaaaaacat
ggtgataagattaccgcaaccgtaagattaataaatgaaaacggtaagcaagtagataaa
gaatatgagcttgaacaaggctcgcaagaccgcttgcaattaatcaagacatcagaaaaa
tag


  DNA with Flanking Sequence

>fig|451515.3.peg.2458 Teicoplanin resistance associated membrane protein TcaA
gccgcagtaagccgacgaattaaaaagttaatcgatgctaaattagttaagttagataaa
ccaaatttaaatattgatcaacgtttgaaattcataaccttaactgacaaaggtagagca
tatttgaaagaacgtaatgcgattatgacagatattgcgcaagatattactaatgattta
aattctgaagatattgaaaatgtaaggcaagtattagaagtcatcaatcatcgcattaaa
acatatagcaatcataaataggtttttgaaggtgttcaaatataagactaaatatgtatg
tattgaacaccttctttttagttataattgagagagtactttcataaataatgtaataag
gtacaattctaaagtaaagttaatcatttcttgaattgtattcttgggataatatttgta
aaataataatggtaaaataatgaaataatttttgtgatatacatataacaattgaagagg
aacagaattgaggtgaaagtatgaaatcttgcccgaagtgcggacaacaagcacaagatg
atgtacagatatgtacacaatgtggacataaatttgatagtcgtcaagcattatatagaa
agtcaaccgatgaagatatacaaactaataacatcaagatgagaaaaatggtgccttggg
caattggttttttcattttaatcttaattattatattgttctttttactaagaaacttca
attcacctgaagcgcaaactaaaatattagtgaatgcgattgagaataatgataaacaaa
aagtagcaacattattaagtactaaagataataaagtagattctgaagaagcaaaagtat
acattaactatatcaaagatgaagttgggcttaagcaatttgtcagcgaccttaaaaata
cggtacataaattgaataagagtaagaccagcgtagcttcttatattcaaaccagatctg
gtcaaaatatattacgtgtaagtaaaaatggcacacgttatatctttttcgataatatga
gctttactgcacctaccaagcaaccaattgttaaaccgaaagaaaaaacaaaatatgagt
ttaaatctggtggtaagaaaaagatggttatagctgaagcaaataaagtgacgccaatag
gtaattttataccggggacatatagaattccagctatgaaatcaactgagaacggtgatt
ttgcaggccatttaaaatttgattttagacaaagtaattctgaaacggtagatgttactg
aagattttgaagaagcaaatatatctgtaactttaaaaggcgatacaaaattaaatgata
gttctaaaaaagtaactataaatgaccatgaaatggcattttcaagttccaaaacgtatg
gtccatatccacaaaataaagatattaccatttcagcttcaggtaaagcgaaagataaaa
catttacaacacagacgaagacgattaaagctagcgatttaaaatacaatacagagataa
ctttgaattttgacagtgaagatatcgaagactatgttgaaaagaaagaaaaagaagaaa
acagcttgaagaacaaattgatagaattctttgctggatattctttagcgaataatgctg
cgtttaatcagtcggattttgattttgtatcatcatatataaaaaaaggatcatcttttt
atgatgatgtaaagaagcgtgtatctaaaggaagtttaatgatgattagttcaccacaaa
ttatagatgctgaaaaacatggtgataagattaccgcaaccgtaagattaataaatgaaa
acggtaagcaagtagataaagaatatgagcttgaacaaggctcgcaagaccgcttgcaat
taatcaagacatcagaaaaatagagtataaaacttaaataagatgcatgtgtcatggaat
acaaacaacatcctttcaaagtatttacaattagtgtgaattactttgaagggattgttt
tttgtggaaaaatttatgaagtgctgaggtttatatcattttataccttttataagttgt
aatgatgttcatgaaacttgtgactaatgctaatatataaaagagcatatttaaatttag
tttctgttcgtgatagttataaactaatcattatataaaggagatagtcatatgaatgat
ttaacgcattttaacaagcgttcaccgatatttattattattttaggatctttgacggcc
attggagcattatcgatagatatgtttttgcctggattaccagatattagacatgatttt
caaacaacgacgtctaacgcacaattaacattatcgatgtttatgattggtttagcgttt
ggtaatttgtttgctggtccaatttcagattcaactgggcgca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005886       C:plasma membrane
GO:0008270       F:zinc ion binding
GO:0016021       C:integral to membrane
cmr|NT05SA2373 Staphylococcus aureus NCTC 8325     TcaA protein
cmr|SAUSA300_2302 Staphylococcus aureus subsp. aureus USA300-FPR3757     teicoplanin resistance associated membrane protein TcaA protein
dbj|BAF68529.1 Staphylococcus aureus subsp. aureus str. Newman     teicoplanin resistance associated protein A
fig|367830.3.peg.194 Staphylococcus aureus subsp. aureus USA300 FIG   Teicoplanin resistance associated membrane protein TcaA
fig|426430.6.peg.2186 Staphylococcus aureus subsp. aureus str. Newman FIG   Teicoplanin resistance associated membrane protein TcaA
fig|426430.8.peg.2455 Staphylococcus aureus subsp. aureus str. Newman FIG   Teicoplanin resistance associated membrane protein TcaA
fig|451516.9.peg.2447 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Teicoplanin resistance associated membrane protein TcaA
fig|546342.3.peg.1026 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Teicoplanin resistance associated membrane protein TcaA
fig|546343.3.peg.1319 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Teicoplanin resistance associated membrane protein TcaA
fig|548474.3.peg.520 Staphylococcus aureus subsp. aureus TCH130 FIG   Teicoplanin resistance associated membrane protein TcaA
fig|553567.3.peg.2133 Staphylococcus aureus A5948 FIG   Teicoplanin resistance associated membrane protein TcaA
fig|553590.4.peg.961 Staphylococcus aureus A9754 FIG   Teicoplanin resistance associated membrane protein TcaA
fig|553594.3.peg.2114 Staphylococcus aureus A9765 FIG   Teicoplanin resistance associated membrane protein TcaA
fig|644279.4.peg.2499 Staphylococcus aureus subsp. aureus 132 FIG   Teicoplanin resistance associated membrane protein TcaA
fig|93061.3.peg.2488 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Teicoplanin resistance associated membrane protein TcaA
fig|93061.5.peg.2383 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Teicoplanin resistance associated membrane protein TcaA
gb|ABD21661.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     teicoplanin resistance associated membrane protein TcaA protein
gb|ABD31644.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX30330.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     teicoplanin resistance protein TcaA
gb|EES96652.1 Staphylococcus aureus subsp. aureus TCH130     teicoplanin resistance associated membrane protein TcaA protein
gb|EEV82545.1 Staphylococcus aureus A5948     teicoplanin resistance associated protein A
gi|122540630 organism not parsed/found in ncbi nr NCBI   RecName: Full=Membrane-associated protein tcaA
gi|123484654 organism not parsed/found in ncbi nr NCBI   RecName: Full=Membrane-associated protein tcaA
gi|150375269 Staphylococcus aureus subsp. aureus str. Newman NCBI   teicoplanin resistance associated protein A
gi|151222469 Staphylococcus aureus subsp. aureus str. Newman NCBI   teicoplanin resistance associated protein A
gi|160369359 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   teicoplanin resistance protein TcaA
gi|161510550 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   teicoplanin resistance protein TcaA
gi|189029835 organism not parsed/found in ncbi nr NCBI   RecName: Full=Membrane-associated protein tcaA
gi|189029836 organism not parsed/found in ncbi nr NCBI   RecName: Full=Membrane-associated protein tcaA
gi|221138034 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   teicoplanin resistance protein TcaA
gi|221141289 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   teicoplanin resistance protein TcaA
gi|253727923 Staphylococcus aureus subsp. aureus TCH130 NCBI   teicoplanin resistance associated membrane protein TcaA protein
gi|253734228 Staphylococcus aureus subsp. aureus TCH130 NCBI   teicoplanin resistance associated membrane protein TcaA protein
gi|257859701 Staphylococcus aureus A5948 NCBI   teicoplanin resistance associated protein A
gi|258452629 Staphylococcus aureus A5948 NCBI   teicoplanin resistance associated protein A
gi|87127147 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   teicoplanin resistance associated membrane protein TcaA protein
gi|87161173 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   teicoplanin resistance associated membrane protein TcaA protein
gi|87203834 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88196276 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02635
img|637888945 Staphylococcus aureus aureus USA300 IMG   teicoplanin resistance associated membrane protein TcaA protein
img|637895245 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640796688 Staphylococcus aureus aureus Newman IMG   teicoplanin resistance associated protein A
img|641310344 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   teicoplanin resistance protein TcaA
kegg|saa:SAUSA300_2302 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   teicoplanin resistance associated membrane protein TcaA protein
kegg|sae:NWMN_2257 Staphylococcus aureus subsp. aureus Newman KEGG   teicoplanin resistance associated protein A
kegg|sao:SAOUHSC_02635 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_2338 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   teicoplanin resistance protein TcaA
ref|YP_001333291.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   teicoplanin resistance associated protein A
ref|YP_001576209.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   teicoplanin resistance protein TcaA
ref|YP_494937.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   teicoplanin resistance associated membrane protein TcaA protein
ref|YP_501096.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02635
ref|ZP_03562836.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   teicoplanin resistance protein TcaA
ref|ZP_03565782.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   teicoplanin resistance protein TcaA
ref|ZP_04868393.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   teicoplanin resistance associated membrane protein TcaA protein
ref|ZP_05700633.1 Staphylococcus aureus A5948 RefSeq   teicoplanin resistance associated protein A
sp|A6QJJ7 Staphylococcus aureus (strain Newman) SwissProt   Membrane-associated protein tcaA
sp|A8Z547 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   Membrane-associated protein tcaA
sp|Q2FEE1 Staphylococcus aureus (strain USA300) SwissProt   Membrane-associated protein tcaA
sp|Q2G2I1 Staphylococcus aureus (strain NCTC 8325) SwissProt   Membrane-associated protein tcaA
sp|TCAA_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Membrane-associated protein tcaA
sp|TCAA_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Membrane-associated protein tcaA
sp|TCAA_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=Membrane-associated protein tcaA
sp|TCAA_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=Membrane-associated protein tcaA
tr|C5Q2M4 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Teicoplanin resistance associated membrane protein TcaA protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search