The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.2399: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: Hypothetical protein SAV2303
Translate Function Assignments



Context on contig NC_007793 from base 2412634 to 2424993 (12360 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2394 2414589 2412634 1956 -           Transcription regulator locus|SAUSA300_2248, protein_id|YP_494883.1, gi|87160916, geneID|3914354
2395 2415199 2416002 804 + 609         Secretory antigen precursor SsaA gene_name|ssaA, locus|SAUSA300_2249, protein_id|YP_494884.1, gi|87160217, geneID|3913090
2396 2416261 2416019 243 - 16         Hypothetical protein SAV2300  
2397 2417835 2416435 1401 - 173         Na+/H+ antiporter NhaC gene_name|nhaC, locus|SAUSA300_2250, protein_id|YP_494885.1, gi|87161037, geneID|3912882
2398 2419012 2417930 1083 - 94         Opine dehydrogenase-like protein locus|SAUSA300_2251, protein_id|YP_494886.1, gi|87160273, geneID|3913675
2399 2419260 2419682 423 + 247         Hypothetical protein SAV2303 locus|SAUSA300_2252, protein_id|YP_494887.1, gi|87160666, geneID|3915043
2400 2419919 2420419 501 + 236         Secretory antigen SsaA homolog gene_name|ssaA, locus|SAUSA300_2253, protein_id|YP_494888.1, gi|87159889, geneID|3914935
2401 2420467 2420724 258 + 47         FIG01108466: hypothetical protein  
2402 2420781 2421734 954 + 56     2: 7 12   Glyoxylate reductase (EC 1.1.1.79) / Glyoxylate reductase (EC 1.1.1.26) / Hydroxypyruvate reductase (EC 1.1.1.81) locus|SAUSA300_2254, protein_id|YP_494889.1, gi|87162105, geneID|3913099
2403 2422950 2421826 1125 - 91     3: 1 10 8   Salicylate hydroxylase (EC 1.14.13.1) locus|SAUSA300_2255, protein_id|YP_494890.1, gi|87161413, geneID|3914101
2404 2424037 2423261 777 - 310     6: 6 4 9 5 3 11   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96) locus|SAUSA300_2256, protein_id|YP_494891.1, gi|87160294, geneID|3913502
2405 2424292 2424059 234 - 21         FIG01108068: hypothetical protein  
2406 2424993 2424520 474 - 227     1: 2   Uncharacterized protein SAV2308 locus|SAUSA300_2257, protein_id|YP_494892.1, gi|87162303, geneID|3913612

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|451515.3.peg.2399 Hypothetical protein SAV2303
MTTEMNDVTNHQPNRKSNDENIMAMLIYLLSLFTSIIGPLIIWLLKKDESKLVDRAGKNY
LNYTISYIIWSIVLVVITLIGVFLIATDIDFIIIIGFIITFIGILSIFAFSILSFVFTII
ACVKYYNGQEYIIPLTIRFI

MD5 = b63e7ec52c38551473f4b3c43565141a


  DNA Sequence

>fig|451515.3.peg.2399 Hypothetical protein SAV2303
atgacaactgaaatgaacgacgtaacaaatcatcaaccgaatcgcaaatccaatgatgag
aacattatggcgatgcttatctatttattaagtttattcacatctattattggtccactg
ataatatggttattgaaaaaagatgaatcgaaactagttgatcgtgctggaaaaaattat
cttaactatacgatttcttatattatttggtctatcgttttagtcgttatcactttaata
ggcgttttcctaattgctacagatattgatttcattattattataggtttcatcattacg
tttatcggtattttatccatattcgctttctcaatattatcttttgtattcacaattatt
gcgtgtgtcaaatattataatggccaagaatatataatacctttaacaattcgatttatt
taa


  DNA with Flanking Sequence

>fig|451515.3.peg.2399 Hypothetical protein SAV2303
atgaagatggaataatcacttgaacaatttcagcatcttttaaaacatattccatatcat
cactaatatcagtgaattttacgaaacgttcatcaccttcattattaaaatcaaatccgc
ccttttcgattgcgttttgaaacttacttatagattgattacgacaatataatttaacat
cgtggcctttgctcaccatatctactgctgccgtaactgcgccatttcctgatcctacaa
ttgctattttcataaacaaccctctttctatctttggttaaaattaaaaacaaattatac
gtaagacaatataaaaatgatgcgaattcattacgcatcattataaatgttaagtatata
taaccttaaattaacctatttaaacgccgacgtccaccaattatttttatttttaataat
tgtttaataaacatgtttatttttgattatattttgttatagttaaagataatattacaa
ttttcaaaggagtgtctaatatgacaactgaaatgaacgacgtaacaaatcatcaaccga
atcgcaaatccaatgatgagaacattatggcgatgcttatctatttattaagtttattca
catctattattggtccactgataatatggttattgaaaaaagatgaatcgaaactagttg
atcgtgctggaaaaaattatcttaactatacgatttcttatattatttggtctatcgttt
tagtcgttatcactttaataggcgttttcctaattgctacagatattgatttcattatta
ttataggtttcatcattacgtttatcggtattttatccatattcgctttctcaatattat
cttttgtattcacaattattgcgtgtgtcaaatattataatggccaagaatatataatac
ctttaacaattcgatttatttaaacatattacaaataaatatttcctattaattatctgt
taatctcattgtaactttgactaatttttattacaaaattagtcaaagtttttttattct
tttacaaatcaataacattccccacaagaagcattaattttgttaaagtaactattgtca
tcaattcgagatgtgagaataaaacagtcgctacgttttatttataaaaaaagatataga
actttggaggactttattcatgaaaaaattagtaacagcaactacgttaacagcaggaat
cggcacagcattagtaggtcaagcacatcatgcagatgctgctgaaaattatacaaatta
caacaactataactacaacacgactcaaactacaacgactacgacaactacgacaactac
atcatcaatttcacattctggtaacttatacactgcaggacaatgtacttggtatgtata
tgataaagttggcggagaaatcggttctacttggggaaatgct


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA2317 Staphylococcus aureus NCTC 8325     putative membrane protein
cmr|SACOL2294 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_2252 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAF68474.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.2162 Staphylococcus aureus subsp. aureus USA300 FIG   Hypothetical protein SAV2303
fig|426430.8.peg.2395 Staphylococcus aureus subsp. aureus str. Newman FIG   Hypothetical protein SAV2303
fig|451516.9.peg.2388 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Hypothetical protein SAV2303
fig|452948.4.peg.1447 Staphylococcus aureus 930918-3 FIG   Hypothetical protein SAV2303
fig|455227.3.peg.524 Staphylococcus aureus D30 FIG   Hypothetical protein SAV2303
fig|546342.3.peg.110 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Hypothetical protein SAV2303
fig|546343.3.peg.238 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Hypothetical protein SAV2303
fig|553567.3.peg.192 Staphylococcus aureus A5948 FIG   Hypothetical protein SAV2303
fig|553590.4.peg.902 Staphylococcus aureus A9754 FIG   Hypothetical protein SAV2303
fig|553594.3.peg.1185 Staphylococcus aureus A9765 FIG   Hypothetical protein SAV2303
fig|644279.4.peg.2439 Staphylococcus aureus subsp. aureus 132 FIG   Hypothetical protein SAV2303
fig|93061.3.peg.2428 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Hypothetical protein SAV2303
fig|93061.5.peg.2323 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Hypothetical protein SAV2303
fig|93062.4.peg.2356 Staphylococcus aureus subsp. aureus COL FIG   Hypothetical protein SAV2303
gb|AAW38514.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD21154.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD31587.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX30277.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical membrane protein
gb|EEV84289.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEW44839.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0935
gb|EEW47978.1 Staphylococcus aureus D30     hypothetical protein SAD30_0101
gi|150375214 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151222414 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_2202
gi|160369306 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical membrane protein
gi|161510497 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_2284
gi|221137123 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_00545
gi|221140231 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_01189
gi|257861487 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258450704 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|259159799 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0935
gi|259163420 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0101
gi|57286420 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57652234 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL2294
gi|87126640 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87160666 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_2252
gi|87203777 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88196219 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02575
img|637153054 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637888895 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637895185 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640796633 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641310291 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical membrane protein
img|641772542 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_2252 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL2294 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_2202 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sao:SAOUHSC_02575 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_2284 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|YP_001333236.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_2202
ref|YP_001576156.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_2284
ref|YP_187101.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL2294
ref|YP_494887.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_2252
ref|YP_501036.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02575
ref|ZP_03561934.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_00545
ref|ZP_03564724.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_01189
ref|ZP_05698763.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QJE2 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8Z3A0 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Hypothetical membrane protein
tr|Q2FEJ1 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2G1V8 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HDQ6 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search