The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.2383: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: Eukaryotic-type low-affinity urea transporter
Translate Function Assignments



Context on contig NC_007793 from base 2398948 to 2410511 (11564 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2377 2399718 2398948 771 -       1: 3   Acetyltransferase (EC 2.3.1.-) locus|SAUSA300_2232, protein_id|YP_494867.1, gi|87160094, geneID|3914927
2378 2400344 2399790 555 - 71     5: 8 9 10 18 4   Substrate-specific component BioY of biotin ECF transporter locus|SAUSA300_2233, protein_id|YP_494868.1, gi|87161625, geneID|3913480
2379 2401406 2400465 942 - 120     5: 7 6 5 11 12   Inosine-uridine preferring nucleoside hydrolase (EC 3.2.2.1) locus|SAUSA300_2234, protein_id|YP_494869.1, gi|87161209, geneID|3912784
2380 2402713 2401805 909 - 398         Ferrichrome ABC transporter, substrate-binding protein FhuD locus|SAUSA300_2235, protein_id|YP_494870.1, gi|87160849, geneID|3913395
2381 2404081 2402927 1155 - 213     3: 13 16 15   Acyl-CoA dehydrogenase locus|SAUSA300_2236, protein_id|YP_494871.1, gi|87161911, geneID|3913002
2382 2404301 2404128 174 - 46         Hypothetical protein SAV2286  
2383 2405203 2404298 906 - -4     1: 1   Eukaryotic-type low-affinity urea transporter locus|SAUSA300_2237, protein_id|YP_494872.1, gi|87161231, geneID|3914785
2384 2405463 2405765 303 + 259     2: 2 1   Urease gamma subunit (EC 3.5.1.5) gene_name|ureA, locus|SAUSA300_2238, protein_id|YP_494873.1, gi|87161108, geneID|3914334
2385 2405779 2406189 411 + 13     2: 2 1   Urease beta subunit (EC 3.5.1.5) gene_name|ureB, locus|SAUSA300_2239, protein_id|YP_494874.1, gi|87160432, geneID|3912935
2386 2406186 2407901 1716 + -4     4: 2 1 14 17   Urease alpha subunit (EC 3.5.1.5) gene_name|ureC, locus|SAUSA300_2240, protein_id|YP_494875.1, gi|87162018, geneID|3915389
2387 2407914 2408366 453 + 12     2: 2 1   Urease accessory protein UreE gene_name|ureE, locus|SAUSA300_2241, protein_id|YP_494876.1, gi|87161428, geneID|3914077
2388 2408359 2409048 690 + -8     2: 2 1   Urease accessory protein UreF gene_name|ureF, locus|SAUSA300_2242, protein_id|YP_494877.1, gi|87161980, geneID|3914877
2389 2409061 2409675 615 + 12     2: 2 1   Urease metallocenter assembly GTPase UreG gene_name|ureG, locus|SAUSA300_2243, protein_id|YP_494878.1, gi|87161408, geneID|3914096
2390 2409675 2410511 837 + -1     2: 2 1   Urease accessory protein UreD gene_name|ureD, locus|SAUSA300_2244, protein_id|YP_494879.1, gi|87160528, geneID|3914008

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Urea_decomposition rodionov Eukaryotic-type low-affinity urea transporter


  Protein Sequence

>fig|451515.3.peg.2383 Eukaryotic-type low-affinity urea transporter
MKIIDVLLKNISQVVLISNKWTGLFILIGLFVADWTIGLAAIVGSIIAYTFARFINYSEA
EINDGLAGFNPVLTAIALTIFLDKSGLDIVITMIATLLTLPVAAAVREVLRPYKVPMLTM
PFVIVTWFTILLSGQVKFVDTSLKLMPQNIETVNFSNNDRIHFIQSLFEGFSQVFIEASV
IGGVCILIGILIASRKATLLAVIASLLSFIIVALLGGNYDDINQGLFGYNFVLMAIALGY
TFKTAINPYISTFLGVLLTVVVQLGTTTLLEPFGLPALTLPFIIVTWILLFAGIKHDKVD
A

MD5 = 668f10d74fc69f9b4ef8813c1fe41bb7


  DNA Sequence

>fig|451515.3.peg.2383 Eukaryotic-type low-affinity urea transporter
ttgaagataatagatgtgcttttgaaaaatatatctcaggttgtgttaattagtaataaa
tggacaggattatttatcttaataggattatttgtagccgattggacaattggattagcg
gctattgtaggtagcatcatcgcctatacttttgcgcgttttataaattatagtgaggca
gagattaatgatgggttagctggatttaatccagtgctaactgccattgcgttaacaatc
tttttagataagtcaggattagatattgttataacaatgatagcaactttattaacgtta
ccagttgctgctgcagtgagagaagttttaagaccatataaagttccgatgctgacgatg
ccttttgtcattgtgacttggtttacaattttactttcaggacaggttaaatttgtagat
acatcgttaaagttaatgcctcaaaacattgaaacggttaattttagcaacaatgataga
atacatttcattcagtcattatttgaaggattcagtcaagtatttatcgaagcgagtgta
attggtggcgtatgtattttaatcggcatattgatagcatcaagaaaagcaacactctta
gctgttatagctagtttgttaagctttatcattgtagctctattaggtggtaattatgat
gatattaatcagggattattcggttataactttgtattaatggcaatcgcactaggatat
acatttaaaacagcgattaacccttatatttcgacttttttaggtgtgttattaacagta
gtggtgcaactaggtacaacaacattgcttgaaccgtttggcttacctgcattaacattg
ccatttattatcgtgacatggattttattatttgctggtattaaacatgacaaagtagat
gcttga


  DNA with Flanking Sequence

>fig|451515.3.peg.2383 Eukaryotic-type low-affinity urea transporter
cgatatctgtaatcatgtgttcgacaccatccatgacatcttctttgtttagaatttgtc
taccataactcattaactctgcaacggtcttaccatcgcgtgcaccttctaataattcat
cgctgattaaagctaatgcctcaggatgatttagtttcaaaccacgtgctttacgacgac
gtgcaacttccgccgccactacaatcattaatttgtcttgctctcgttgtgtaaaatgca
aattaaaacccccaatttcatattagatacaatttacaaaatttatattaatcctaattg
ttgtgataaacaagtaatatacaaagttcaatgtgtaattagaaaattatatttttagca
tatccgatattgaagcaaacaatctaatcgaaaacaaatagtggaatatatttatgtaaa
aaccaaaatagtttttaatataacttttcatagaatagtagtatattaatgagtaatgat
tcaaaggaaaggtgaaagatttgaagataatagatgtgcttttgaaaaatatatctcagg
ttgtgttaattagtaataaatggacaggattatttatcttaataggattatttgtagccg
attggacaattggattagcggctattgtaggtagcatcatcgcctatacttttgcgcgtt
ttataaattatagtgaggcagagattaatgatgggttagctggatttaatccagtgctaa
ctgccattgcgttaacaatctttttagataagtcaggattagatattgttataacaatga
tagcaactttattaacgttaccagttgctgctgcagtgagagaagttttaagaccatata
aagttccgatgctgacgatgccttttgtcattgtgacttggtttacaattttactttcag
gacaggttaaatttgtagatacatcgttaaagttaatgcctcaaaacattgaaacggtta
attttagcaacaatgatagaatacatttcattcagtcattatttgaaggattcagtcaag
tatttatcgaagcgagtgtaattggtggcgtatgtattttaatcggcatattgatagcat
caagaaaagcaacactcttagctgttatagctagtttgttaagctttatcattgtagctc
tattaggtggtaattatgatgatattaatcagggattattcggttataactttgtattaa
tggcaatcgcactaggatatacatttaaaacagcgattaacccttatatttcgacttttt
taggtgtgttattaacagtagtggtgcaactaggtacaacaacattgcttgaaccgtttg
gcttacctgcattaacattgccatttattatcgtgacatggattttattatttgctggta
ttaaacatgacaaagtagatgcttgatagttaaatcaaacctaatattgtttgaatatca
ccttaaactatacagcgaattgtatagtttaaggtgtatttttatggataaaattaagtg
catacttaatcgaattatcagttttcttttaattgttcacagcacgttcctttttatttt
taaagtcgagtgttaaactaggaataaataatttatattgtgtgttgtgtggggtgacta
atatgaatgatatggataattcctttttaataacaacggaaattcaaagaaaatggattg
aaaaattcaaagtaattagagatacatttaaggctaaagctgaatataatgatcaacata
gccaatttccatataaaaatattgaatggttaattaaagaaggttatggaaaattaacgt
taccaaaagcatatggtggtgaaggtgcgaccatagaagacatggttattttgcaatcat
ttttaggcgaacttgatggtgccacagcattatctattggttggca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0015204       F:urea transmembrane transporter activity
GO:0015840       P:urea transport
GO:0016021       C:integral to membrane
cmr|NT05SA2302 Staphylococcus aureus NCTC 8325     urea transporter
cmr|SACOL2279 Staphylococcus aureus subsp. aureus COL     urea transporter
fig|426430.6.peg.2123 Staphylococcus aureus subsp. aureus str. Newman FIG   Eukaryotic-type low-affinity urea transporter
fig|426430.8.peg.2379 Staphylococcus aureus subsp. aureus str. Newman FIG   Eukaryotic-type low-affinity urea transporter
fig|451516.9.peg.2372 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Eukaryotic-type low-affinity urea transporter
fig|452948.4.peg.1431 Staphylococcus aureus 930918-3 FIG   Eukaryotic-type low-affinity urea transporter
fig|455227.3.peg.508 Staphylococcus aureus D30 FIG   Eukaryotic-type low-affinity urea transporter
fig|546342.3.peg.126 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Eukaryotic-type low-affinity urea transporter
fig|546343.3.peg.222 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Eukaryotic-type low-affinity urea transporter
fig|553567.3.peg.208 Staphylococcus aureus A5948 FIG   Eukaryotic-type low-affinity urea transporter
fig|553590.4.peg.886 Staphylococcus aureus A9754 FIG   Eukaryotic-type low-affinity urea transporter
fig|553594.3.peg.1169 Staphylococcus aureus A9765 FIG   Eukaryotic-type low-affinity urea transporter
fig|644279.4.peg.2423 Staphylococcus aureus subsp. aureus 132 FIG   Eukaryotic-type low-affinity urea transporter
fig|93061.5.peg.2307 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Eukaryotic-type low-affinity urea transporter
fig|93062.19.peg.2221 Staphylococcus aureus subsp. aureus COL FIG   Eukaryotic-type low-affinity urea transporter
fig|93062.4.peg.2341 Staphylococcus aureus subsp. aureus COL FIG   Eukaryotic-type low-affinity urea transporter
gb|AAW38499.1 Staphylococcus aureus subsp. aureus COL     transporter, putative
gb|EEV84305.1 Staphylococcus aureus A5948     urea transporter
gb|EEW44859.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0955
gb|EEW47962.1 Staphylococcus aureus D30     hypothetical protein SAD30_0085
gi|221137138 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   UT family urea transporter
gi|221140216 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   UT family urea transporter
gi|257861503 Staphylococcus aureus A5948 NCBI   urea transporter
gi|258450720 Staphylococcus aureus A5948 NCBI   urea transporter
gi|259159819 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0955
gi|259163404 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0085
gi|57286405 Staphylococcus aureus subsp. aureus COL NCBI   transporter, putative
gi|57652219 Staphylococcus aureus subsp. aureus COL NCBI   transporter, putative
img|637153039 Staphylococcus aureus aureus COL IMG   transporter, putative
img|641772950 Staphylococcus aureus aureus USA300_TCH959 IMG   UT family urea transporter
kegg|sac:SACOL2279 Staphylococcus aureus subsp. aureus COL KEGG   transporter, putative
ref|YP_187086.1 Staphylococcus aureus subsp. aureus COL RefSeq   transporter, putative
ref|ZP_03561949.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   UT family urea transporter
ref|ZP_03564709.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   UT family urea transporter
ref|ZP_05698779.1 Staphylococcus aureus A5948 RefSeq   urea transporter
tr|Q5HDS1 Staphylococcus aureus (strain COL) TrEMBL   Transporter, putative


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search