The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.2362: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: Transcriptional regulator SarV (Staphylococcal accessory regulator V)
Translate Function Assignments



Context on contig NC_007793 from base 2380364 to 2393903 (13540 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2356 2383531 2380364 3168 -       1: 7   RND multidrug efflux transporter; Acriflavin resistance protein locus|SAUSA300_2213, protein_id|YP_494848.1, gi|87160279, geneID|3913486
2357 2384913 2383648 1266 - 116     1: 5 dlit(10430946)
dlit(15228543)
tRNA-dependent lipid II--glycine ligase (FmhB) locus|SAUSA300_2214, protein_id|YP_494849.1, gi|87161975, geneID|3914487
2358 2385293 2385553 261 + 379         Hypothetical protein SAV2263  
2359 2386309 2385545 765 - -9         Hypothetical protein SAV2264 locus|SAUSA300_2215, protein_id|YP_494850.1, gi|87160067, geneID|3913291
2360 2386471 2386911 441 + 161     3: 3 4 6   Transcriptional regulator, MarR family locus|SAUSA300_2216, protein_id|YP_494851.1, gi|87160317, geneID|3915392
2361 2386904 2388115 1212 + -8       dlit(9869592) Major facilitator family transporter locus|SAUSA300_2217, protein_id|YP_494852.1, gi|87162185, geneID|3913882
2362 2388567 2388217 351 - 101       dlit(15292128) Transcriptional regulator SarV (Staphylococcal accessory regulator V) locus|SAUSA300_2218, protein_id|YP_494853.1, gi|87161800, geneID|3914043
2363 2389054 2388920 135 - 352         FIG01109757: hypothetical protein  
2364 2390280 2389258 1023 - 203     1: 1 dlit(26575208)
dlit(25941396)
GTP 3',8-cyclase (EC 4.1.99.22) ## MoaA gene_name|moaA, locus|SAUSA300_2219, protein_id|YP_494854.1, gi|87161067, geneID|3912777
2365 2390899 2390300 600 - 19     2: 2 1   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77) gene_name|mobA, locus|SAUSA300_2220, protein_id|YP_494855.1, gi|87161876, geneID|3914564
2366 2391139 2390906 234 - 6     2: 2 1   Molybdopterin synthase sulfur carrier subunit ## MoaD gene_name|moaD, locus|SAUSA300_2221, protein_id|YP_494856.1, gi|87160189, geneID|3913257
2367 2391591 2391145 447 - 5     2: 2 1   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12) gene_name|moaE, locus|SAUSA300_2222, protein_id|YP_494857.1, gi|87161879, geneID|3914567
2368 2392090 2391605 486 - 13     2: 2 1   Molybdopterin-guanine dinucleotide biosynthesis protein MobB gene_name|mobB, locus|SAUSA300_2223, protein_id|YP_494858.1, gi|87160185, geneID|3913253
2369 2393346 2392087 1260 - -4     2: 2 1   Molybdopterin biosynthesis protein MoeA gene_name|moeA, locus|SAUSA300_2224, protein_id|YP_494859.1, gi|87160744, geneID|3913407
2370 2393409 2393903 495 + 62     2: 2 1   Molybdenum cofactor biosynthesis protein MoaC gene_name|moaC, locus|SAUSA300_2225, protein_id|YP_494860.1, gi|87161640, geneID|3913690

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|451515.3.peg.2362 Transcriptional regulator SarV (Staphylococcal accessory regulator V)
MSNKVQRFIEAERELSQLKHWLKTTHKISIEEFVVLFKVYEAEKISGKELRDTLHFEMLW
DTSKIDVIIRKIYKKELISKLRSETDERQVFYFYSTSQKKLLDKITKEIEVLSVTN

MD5 = b448b0bbe2e6ab206efd1e65ff053ad3


  DNA Sequence

>fig|451515.3.peg.2362 Transcriptional regulator SarV (Staphylococcal accessory regulator V)
atgagtaataaagttcaacgttttatagaagcagaaagggagttaagtcagttaaagcac
tggttaaaaacaacacataagatttcaattgaagaatttgtagtcctttttaaagtgtat
gaagctgaaaagattagcggtaaagaattgagggatacattacattttgaaatgctatgg
gatacaagtaaaatcgatgtgattatccgtaaaatctataaaaaagagcttatttctaaa
ttgcgttctgaaacggatgaaagacaagtattctatttctatagtacttctcaaaagaaa
ttgttagataaaattactaaagaaatagaagtgttaagcgttacaaactaa


  DNA with Flanking Sequence

>fig|451515.3.peg.2362 Transcriptional regulator SarV (Staphylococcal accessory regulator V)
aataatgtgcaagttggcggggccccaacatagagaatttcaaaaagaaattctacagac
aatgcaagttggggaacggggccccaacacagaaggtgacgaaaagtcagcatacaataa
tgtgcaagttggcggggccccaacatagagaatttcaaaagaaattctacagacaatgca
agttggggatcaacgaaataaattttatgagaatatcatttctatcccactcttaagaat
cactacataataaatctttagtggttctttaacattgatgtcacactccatgccattgag
ttgtaatatatcttttttaggtataaatgttgtcgaataaacaacaagttgtccaaaaga
tataaatctaaacaagatatagccagcaatttaatatttgtaatagataaaatgctaagt
ttgatatataataaatttaagtaattgtataataatatgaattacaaacatctaagaaga
aacataggaggcatcatattatgagtaataaagttcaacgttttatagaagcagaaaggg
agttaagtcagttaaagcactggttaaaaacaacacataagatttcaattgaagaatttg
tagtcctttttaaagtgtatgaagctgaaaagattagcggtaaagaattgagggatacat
tacattttgaaatgctatgggatacaagtaaaatcgatgtgattatccgtaaaatctata
aaaaagagcttatttctaaattgcgttctgaaacggatgaaagacaagtattctatttct
atagtacttctcaaaagaaattgttagataaaattactaaagaaatagaagtgttaagcg
ttacaaactaaaaacttaaaaagcatgccaatcagtacatcataattgcgtcttggggac
agacaaatgatgaatagagattggcatgctttttatttttgaatataaatatttagttca
tggcatttctagttacatgacgtccatgaattaagaagtaaacaagcatagtaatgattg
ctaaagcggccataaagccgaagatttcactatatgaaaacatatgagtaaataacccaa
ggaatgatggaccgaagccgacacctgcatctagaccaacgtaaaaagtagatgtcgcga
taccatatttaatcgggggtgagacttttatcgcaatagattgcattgcagatgataaat
ttccataccctaaacctaggcaagcaccagcaagtaatattaaccagctttgatagcttg
aaattaagcatacaaatgaaaggaaaagcatgataaatgctgggtagacaataatatttt
catttttatcatccatcaatctaccagcaat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003700       F:transcription factor activity
GO:0005622       C:intracellular
GO:0005737       C:cytoplasm
GO:0006350       P:transcription
GO:0006355       P:regulation of transcription, DNA-dependent
GO:0009405       P:pathogenesis
cmr|NT01SA2277 Staphylococcus aureus N315     conserved hypothetical protein
cmr|NT02SA2270 Staphylococcus aureus Mu50     conserved hypothetical protein
cmr|NT03SA2359 Staphylococcus aureus MW2     staphylococcal accessory regulator V
cmr|NT05SA2281 Staphylococcus aureus NCTC 8325     HTH-type transcriptional regulator SarV
cmr|NT08SA2326 Staphylococcus aureus subsp. aureus MRSA252     staphylococcal accessory protein X, putative
cmr|NT09SA2172 Staphylococcus aureus subsp. aureus MSSA476     staphylococcal accessory protein X, putative
cmr|SACOL2258 Staphylococcus aureus subsp. aureus COL     staphylococcal accessory regulator V
cmr|SAUSA300_2218 Staphylococcus aureus subsp. aureus USA300-FPR3757     staphylococcal accessory regulator
dbj|BAB43359.1 Staphylococcus aureus subsp. aureus N315     hypothetical protein
dbj|BAB58429.1 Staphylococcus aureus subsp. aureus Mu50     hypothetical protein
dbj|BAB96050.1 Staphylococcus aureus subsp. aureus MW2     hypothetical protein
dbj|BAF68439.1 Staphylococcus aureus subsp. aureus str. Newman     staphylococcal accessory regulator V
dbj|BAF79134.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
emb|CAG41332.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   hypothetical protein
emb|CAG43968.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   hypothetical protein
fig|158878.1.peg.2267 Staphylococcus aureus subsp. aureus Mu50 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|158878.14.peg.2345 Staphylococcus aureus subsp. aureus Mu50 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|158879.1.peg.2142 Staphylococcus aureus subsp. aureus N315 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|158879.11.peg.2236 Staphylococcus aureus subsp. aureus N315 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|196620.1.peg.2185 Staphylococcus aureus subsp. aureus MW2 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|196620.5.peg.2257 Staphylococcus aureus subsp. aureus MW2 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|282458.1.peg.2223 Staphylococcus aureus subsp. aureus MRSA252 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|282458.4.peg.2363 Staphylococcus aureus subsp. aureus MRSA252 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|282459.1.peg.2135 Staphylococcus aureus subsp. aureus MSSA476 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|282459.5.peg.2242 Staphylococcus aureus subsp. aureus MSSA476 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|359786.13.peg.2425 Staphylococcus aureus subsp. aureus JH9 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|359786.3.peg.2281 Staphylococcus aureus subsp. aureus JH9 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|359787.11.peg.2387 Staphylococcus aureus subsp. aureus JH1 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|359787.3.peg.2123 Staphylococcus aureus subsp. aureus JH1 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|367830.3.peg.1793 Staphylococcus aureus subsp. aureus USA300 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|418127.4.peg.2080 Staphylococcus aureus subsp. aureus Mu3 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|418127.6.peg.2309 Staphylococcus aureus subsp. aureus Mu3 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|426430.6.peg.2104 Staphylococcus aureus subsp. aureus str. Newman FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|426430.8.peg.2356 Staphylococcus aureus subsp. aureus str. Newman FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|450394.6.peg.1477 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|451516.9.peg.2351 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|452948.4.peg.1158 Staphylococcus aureus 930918-3 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|455227.3.peg.486 Staphylococcus aureus D30 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|505321.3.peg.47 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|546342.3.peg.2011 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|546343.3.peg.137 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|548470.3.peg.1087 Staphylococcus aureus subsp. aureus MN8 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|548473.3.peg.333 Staphylococcus aureus subsp. aureus TCH60 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|548474.3.peg.615 Staphylococcus aureus subsp. aureus TCH130 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|548475.3.peg.1906 Staphylococcus aureus subsp. aureus TCH70 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|553565.3.peg.2140 Staphylococcus aureus A5937 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|553567.3.peg.230 Staphylococcus aureus A5948 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|553568.3.peg.2594 Staphylococcus aureus A6224 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|553571.3.peg.1664 Staphylococcus aureus A6300 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|553573.3.peg.655 Staphylococcus aureus A8115 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|553574.3.peg.1052 Staphylococcus aureus A8117 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|553577.3.peg.91 Staphylococcus aureus A8796 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|553580.3.peg.93 Staphylococcus aureus A8819 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|553581.3.peg.2630 Staphylococcus aureus A9299 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|553583.3.peg.229 Staphylococcus aureus A9635 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|553588.3.peg.2719 Staphylococcus aureus A9719 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|553590.4.peg.865 Staphylococcus aureus A9754 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|553592.3.peg.1079 Staphylococcus aureus A9763 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|553594.3.peg.1147 Staphylococcus aureus A9765 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|553596.3.peg.1510 Staphylococcus aureus A9781 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|553601.3.peg.493 Staphylococcus aureus A10102 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|585143.3.peg.731 Staphylococcus aureus subsp. aureus 55/2053 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|585144.3.peg.716 Staphylococcus aureus subsp. aureus 58-424 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|585145.3.peg.526 Staphylococcus aureus subsp. aureus 65-1322 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|585146.3.peg.97 Staphylococcus aureus subsp. aureus 68-397 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|585147.3.peg.1816 Staphylococcus aureus subsp. aureus A017934/97 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|585148.3.peg.2040 Staphylococcus aureus subsp. aureus Btn1260 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|585149.6.peg.2434 Staphylococcus aureus subsp. aureus C101 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|585150.3.peg.649 Staphylococcus aureus subsp. aureus C160 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|585151.3.peg.1976 Staphylococcus aureus subsp. aureus C427 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|585153.3.peg.529 Staphylococcus aureus subsp. aureus E1410 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|585154.3.peg.2321 Staphylococcus aureus subsp. aureus EMRSA16 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|585156.3.peg.1813 Staphylococcus aureus subsp. aureus M1015 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|585157.3.peg.1930 Staphylococcus aureus subsp. aureus M809 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|585158.3.peg.307 Staphylococcus aureus subsp. aureus M876 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|585159.3.peg.2362 Staphylococcus aureus subsp. aureus M899 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|585160.3.peg.2071 Staphylococcus aureus subsp. aureus WBG10049 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|585161.3.peg.2093 Staphylococcus aureus subsp. aureus WW2703/97 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|585891.3.peg.2341 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|644279.4.peg.2403 Staphylococcus aureus subsp. aureus 132 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|680649.3.peg.2147 Staphylococcus aureus subsp. aureus MR1 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|681288.4.peg.2289 Staphylococcus aureus subsp. aureus ED98 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|703339.3.peg.2251 Staphylococcus aureus 04-02981 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|762962.3.peg.2251 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|93061.3.peg.2388 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|93061.5.peg.2284 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|93062.19.peg.2200 Staphylococcus aureus subsp. aureus COL FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
fig|93062.4.peg.2320 Staphylococcus aureus subsp. aureus COL FIG   Transcriptional regulator SarV (Staphylococcal accessory regulator V)
gb|AAW37130.1 Staphylococcus aureus subsp. aureus COL     staphylococcal accessory regulator V
gb|ABD22288.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     staphylococcal accessory regulator
gb|ABD31547.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ50072.1 Staphylococcus aureus subsp. aureus JH9     transcriptional regulator, SarA family
gb|ABR53159.1 Staphylococcus aureus subsp. aureus JH1     staphylococcal accessory regulator family
gb|ABX30241.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_2248
gb|EEI96520.1 Staphylococcus aureus subsp. aureus MN8     conserved hypothetical protein
gb|EEJ62514.1 Staphylococcus aureus subsp. aureus TCH60     conserved hypothetical protein
gb|EES55737.1 Staphylococcus aureus subsp. aureus TCH70     conserved hypothetical protein
gb|EES95108.1 Staphylococcus aureus subsp. aureus USA300_TCH959     conserved hypothetical protein
gb|EES96470.1 Staphylococcus aureus subsp. aureus TCH130     conserved hypothetical protein
gb|EEV04870.1 Staphylococcus aureus subsp. aureus 55/2053     HTH-type transcriptional regulator sarV
gb|EEV07510.1 Staphylococcus aureus subsp. aureus 65-1322     staphylococcal accessory regulator family
gb|EEV10135.1 Staphylococcus aureus subsp. aureus 68-397     HTH-type transcriptional regulator sarV
gb|EEV12724.1 Staphylococcus aureus subsp. aureus E1410     staphylococcal accessory regulator V
gb|EEV15386.1 Staphylococcus aureus subsp. aureus M876     staphylococcal accessory regulator V
gb|EEV26923.1 Staphylococcus aureus A9781     staphylococcal accessory regulator
gb|EEV64929.1 Staphylococcus aureus A9763     staphylococcal accessory regulator
gb|EEV66252.1 Staphylococcus aureus A9719     HTH-type transcriptional regulator sarV
gb|EEV71132.1 Staphylococcus aureus A9635     staphylococcal accessory regulator family
gb|EEV71552.1 Staphylococcus aureus A9299     HTH-type transcriptional regulator sarV
gb|EEV75725.1 Staphylococcus aureus A8115     transcriptional regulator
gb|EEV77647.1 Staphylococcus aureus A6300     HTH-type transcriptional regulator sarV
gb|EEV79252.1 Staphylococcus aureus A6224     staphylococcal accessory regulator V
gb|EEV84324.1 Staphylococcus aureus A5948     staphylococcal accessory regulator V
gb|EEV85356.1 Staphylococcus aureus A5937     transcriptional regulator
gb|EEW45133.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0616
gb|EEW47944.1 Staphylococcus aureus D30     hypothetical protein SAD30_0067
gi|114152155 organism not parsed/found in ncbi nr NCBI   RecName: Full=HTH-type transcriptional regulator sarV; AltName: Full=Staphylococcal accessory regulator V
gi|13702067 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein
gi|14248040 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein
gi|147741774 Staphylococcus aureus subsp. aureus JH9 NCBI   transcriptional regulator, SarA family
gi|148268705 Staphylococcus aureus subsp. aureus JH9 NCBI   SarA family transcriptional regulator
gi|149947223 Staphylococcus aureus subsp. aureus JH1 NCBI   staphylococcal accessory regulator family
gi|150375179 Staphylococcus aureus subsp. aureus str. Newman NCBI   staphylococcal accessory regulator V
gi|150394771 Staphylococcus aureus subsp. aureus JH1 NCBI   accessory regulator A-like protein
gi|151222379 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_2167
gi|156722717 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156980582 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_2251
gi|15925257 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV2267
gi|15927847 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA2062
gi|160369270 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_2248
gi|161510461 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_2248
gi|21205356 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein
gi|21283914 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW2185
gi|221138967 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_10060
gi|221140133 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_00689
gi|227246761 Staphylococcus aureus subsp. aureus MN8 NCBI   conserved hypothetical protein
gi|227556903 Staphylococcus aureus subsp. aureus MN8 NCBI   conserved hypothetical protein
gi|227852716 Staphylococcus aureus subsp. aureus TCH60 NCBI   conserved hypothetical protein
gi|227898963 Staphylococcus aureus subsp. aureus TCH60 NCBI   conserved hypothetical protein
gi|251803080 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|251813307 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|253314608 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_00245
gi|253726379 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   conserved hypothetical protein
gi|253727741 Staphylococcus aureus subsp. aureus TCH130 NCBI   conserved hypothetical protein
gi|253729932 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   conserved hypothetical protein
gi|253734325 Staphylococcus aureus subsp. aureus TCH130 NCBI   conserved hypothetical protein
gi|255007045 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_11270
gi|257272768 Staphylococcus aureus subsp. aureus 55/2053 NCBI   HTH-type transcriptional regulator sarV
gi|257276059 Staphylococcus aureus subsp. aureus 65-1322 NCBI   staphylococcal accessory regulator family
gi|257279548 Staphylococcus aureus subsp. aureus 68-397 NCBI   HTH-type transcriptional regulator sarV
gi|257282592 Staphylococcus aureus subsp. aureus E1410 NCBI   staphylococcal accessory regulator V
gi|257285270 Staphylococcus aureus subsp. aureus M876 NCBI   staphylococcal accessory regulator V
gi|257423750 Staphylococcus aureus subsp. aureus 55/2053 NCBI   HTH-type transcriptional regulator sarV
gi|257426428 Staphylococcus aureus subsp. aureus 65-1322 NCBI   staphylococcal accessory regulator family
gi|257429067 Staphylococcus aureus subsp. aureus 68-397 NCBI   HTH-type transcriptional regulator sarV
gi|257431713 Staphylococcus aureus subsp. aureus E1410 NCBI   staphylococcal accessory regulator V
gi|257434674 Staphylococcus aureus subsp. aureus M876 NCBI   staphylococcal accessory regulator V
gi|257788583 Staphylococcus aureus A9781 NCBI   staphylococcal accessory regulator
gi|257794611 Staphylococcus aureus A9781 NCBI   staphylococcal accessory regulator
gi|257840469 Staphylococcus aureus A9763 NCBI   staphylococcal accessory regulator
gi|257841815 Staphylococcus aureus A9719 NCBI   HTH-type transcriptional regulator sarV
gi|257847123 Staphylococcus aureus A9635 NCBI   staphylococcal accessory regulator family
gi|257847550 Staphylococcus aureus A9299 NCBI   HTH-type transcriptional regulator sarV
gi|257851791 Staphylococcus aureus A8115 NCBI   transcriptional regulator
gi|257854699 Staphylococcus aureus A6300 NCBI   HTH-type transcriptional regulator sarV
gi|257856343 Staphylococcus aureus A6224 NCBI   staphylococcal accessory regulator V
gi|257861522 Staphylococcus aureus A5948 NCBI   staphylococcal accessory regulator V
gi|257862588 Staphylococcus aureus A5937 NCBI   transcriptional regulator
gi|258408786 Staphylococcus aureus A9763 NCBI   staphylococcal accessory regulator
gi|258422384 Staphylococcus aureus A9719 NCBI   HTH-type transcriptional regulator sarV
gi|258422712 Staphylococcus aureus A9635 NCBI   staphylococcal accessory regulator family
gi|258439774 Staphylococcus aureus A9299 NCBI   HTH-type transcriptional regulator sarV
gi|258442670 Staphylococcus aureus A8115 NCBI   transcriptional regulator
gi|258446631 Staphylococcus aureus A6300 NCBI   HTH-type transcriptional regulator sarV
gi|258450251 Staphylococcus aureus A6224 NCBI   staphylococcal accessory regulator V
gi|258450739 Staphylococcus aureus A5948 NCBI   staphylococcal accessory regulator V
gi|258455377 Staphylococcus aureus A5937 NCBI   transcriptional regulator
gi|259160100 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0616
gi|259163386 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0067
gi|49242611 Staphylococcus aureus subsp. aureus MRSA252 NCBI   hypothetical protein
gi|49245491 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein
gi|49484482 Staphylococcus aureus subsp. aureus MRSA252 NCBI   hypothetical protein SAR2351
gi|49487048 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS2157
gi|57285036 Staphylococcus aureus subsp. aureus COL NCBI   staphylococcal accessory regulator V
gi|57650850 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL2258
gi|81648817 organism not parsed/found in ncbi nr NCBI   RecName: Full=HTH-type transcriptional regulator sarV; AltName: Full=Staphylococcal accessory regulator V
gi|81650569 organism not parsed/found in ncbi nr NCBI   RecName: Full=HTH-type transcriptional regulator sarV; AltName: Full=Staphylococcal accessory regulator V
gi|81693945 organism not parsed/found in ncbi nr NCBI   RecName: Full=HTH-type transcriptional regulator sarV; AltName: Full=Staphylococcal accessory regulator V
gi|81704213 organism not parsed/found in ncbi nr NCBI   RecName: Full=HTH-type transcriptional regulator sarV; AltName: Full=Staphylococcal accessory regulator V
gi|81705232 organism not parsed/found in ncbi nr NCBI   RecName: Full=HTH-type transcriptional regulator sarV; AltName: Full=Staphylococcal accessory regulator V
gi|81855893 organism not parsed/found in ncbi nr NCBI   RecName: Full=HTH-type transcriptional regulator sarV; AltName: Full=Staphylococcal accessory regulator V
gi|87127774 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   staphylococcal accessory regulator
gi|87161800 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_2218
gi|87203737 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88196179 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02532
img|637093810 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637100824 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637153018 Staphylococcus aureus aureus COL IMG   staphylococcal accessory regulator V
img|637155784 Staphylococcus aureus aureus MRSA252 IMG   hypothetical protein
img|637158426 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637300002 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637888861 Staphylococcus aureus aureus USA300 IMG   staphylococcal accessory regulator
img|637895145 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639109265 Staphylococcus aureus aureus JH1 IMG   accessory regulator
img|640566680 Staphylococcus aureus aureus JH9 IMG   transcriptional regulator, SarA family
img|640780446 Staphylococcus aureus aureus JH1 IMG   staphylococcal accessory regulator family
img|640796598 Staphylococcus aureus aureus Newman IMG   staphylococcal accessory regulator V
img|640905049 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641310255 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
img|641772623 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_2218 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL2258 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_2167 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sah:SaurJH1_2334 Staphylococcus aureus subsp. aureus JH1 KEGG   accessory regulator A-like protein
kegg|saj:SaurJH9_2292 Staphylococcus aureus subsp. aureus JH9 KEGG   SarA family transcriptional regulator
kegg|sam:MW2185 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_02532 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sar:SAR2351   KEGG   hypothetical protein
kegg|sas:SAS2157   KEGG   hypothetical protein
kegg|sau:SA2062   KEGG   hypothetical protein
kegg|sav:SAV2267   KEGG   hypothetical protein
kegg|saw:SAHV_2251 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_2248 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|NP_372791.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV2267
ref|NP_375380.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA2062
ref|NP_647002.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW2185
ref|YP_001247648.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   SarA family transcriptional regulator
ref|YP_001317446.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   accessory regulator A-like protein
ref|YP_001333201.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_2167
ref|YP_001442841.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_2251
ref|YP_001576120.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_2248
ref|YP_041706.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   hypothetical protein SAR2351
ref|YP_044269.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS2157
ref|YP_187065.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL2258
ref|YP_494853.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_2218
ref|YP_500996.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02532
ref|ZP_03563768.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_10060
ref|ZP_03564626.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_00689
ref|ZP_03986950.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   conserved hypothetical protein
ref|ZP_04016768.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   conserved hypothetical protein
ref|ZP_04827780.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   conserved hypothetical protein
ref|ZP_04837821.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_00245
ref|ZP_04864097.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   conserved hypothetical protein
ref|ZP_04868490.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   conserved hypothetical protein
ref|ZP_05145646.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_11270
ref|ZP_05600179.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   HTH-type transcriptional regulator sarV
ref|ZP_05602830.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   staphylococcal accessory regulator family
ref|ZP_05605454.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   HTH-type transcriptional regulator sarV
ref|ZP_05608076.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   staphylococcal accessory regulator V
ref|ZP_05610725.1 Staphylococcus aureus subsp. aureus M876 RefSeq   staphylococcal accessory regulator V
ref|ZP_05643590.1 Staphylococcus aureus A9781 RefSeq   staphylococcal accessory regulator
ref|ZP_05681070.1 Staphylococcus aureus A9763 RefSeq   staphylococcal accessory regulator
ref|ZP_05685296.1 Staphylococcus aureus A9719 RefSeq   HTH-type transcriptional regulator sarV
ref|ZP_05685617.1 Staphylococcus aureus A9635 RefSeq   staphylococcal accessory regulator family
ref|ZP_05690520.1 Staphylococcus aureus A9299 RefSeq   HTH-type transcriptional regulator sarV
ref|ZP_05691230.1 Staphylococcus aureus A8115 RefSeq   transcriptional regulator
ref|ZP_05694786.1 Staphylococcus aureus A6300 RefSeq   HTH-type transcriptional regulator sarV
ref|ZP_05698343.1 Staphylococcus aureus A6224 RefSeq   staphylococcal accessory regulator V
ref|ZP_05698798.1 Staphylococcus aureus A5948 RefSeq   staphylococcal accessory regulator V
ref|ZP_05703337.1 Staphylococcus aureus A5937 RefSeq   transcriptional regulator
sp|Q2FVY9 Staphylococcus aureus (strain NCTC 8325) SwissProt   HTH-type transcriptional regulator sarV
sp|Q5HDU2 Staphylococcus aureus (strain COL) SwissProt   HTH-type transcriptional regulator sarV
sp|Q6G755 Staphylococcus aureus (strain MSSA476) SwissProt   HTH-type transcriptional regulator sarV
sp|Q6GEG7 Staphylococcus aureus (strain MRSA252) SwissProt   HTH-type transcriptional regulator sarV
sp|Q7A071 Staphylococcus aureus (strain MW2) SwissProt   HTH-type transcriptional regulator sarV
sp|Q7A442 Staphylococcus aureus (strain N315) SwissProt   HTH-type transcriptional regulator sarV
sp|Q99S05 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   HTH-type transcriptional regulator sarV
sp|SARV_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=HTH-type transcriptional regulator sarV; AltName: Full=Staphylococcal accessory regulator V
sp|SARV_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=HTH-type transcriptional regulator sarV; AltName: Full=Staphylococcal accessory regulator V
sp|SARV_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=HTH-type transcriptional regulator sarV; AltName: Full=Staphylococcal accessory regulator V
sp|SARV_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=HTH-type transcriptional regulator sarV; AltName: Full=Staphylococcal accessory regulator V
sp|SARV_STAAR organism not parsed/found in ncbi nr SwissProt   RecName: Full=HTH-type transcriptional regulator sarV; AltName: Full=Staphylococcal accessory regulator V
sp|SARV_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=HTH-type transcriptional regulator sarV; AltName: Full=Staphylococcal accessory regulator V
sp|SARV_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=HTH-type transcriptional regulator sarV; AltName: Full=Staphylococcal accessory regulator V
tr|A5IV49 Staphylococcus aureus (strain JH9) TrEMBL   Transcriptional regulator, SarA family
tr|A6QJA7 Staphylococcus aureus (strain Newman) TrEMBL   Staphylococcal accessory regulator V
tr|A6U3Z1 Staphylococcus aureus (strain JH1) TrEMBL   Staphylococcal accessory regulator family
tr|A7X5I9 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|A8Z364 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|C2G8T5 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   Putative uncharacterized protein
tr|C2K4B0 Staphylococcus aureus subsp. aureus MN8 TrEMBL   Putative uncharacterized protein
tr|C5MZF5 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Putative uncharacterized protein
tr|C5Q2X1 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Putative uncharacterized protein
tr|C5QG64 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Putative uncharacterized protein
tr|Q2FEM5 Staphylococcus aureus (strain USA300) TrEMBL   Staphylococcal accessory regulator


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(15292128);SvetaG


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search