The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
 The SEED


FIG search

Protein fig|451515.3.peg.2338: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: LSU ribosomal protein L16p (L10e)
Translate Function Assignments


Context on contig NC_007793 from base 2360863 to 2372099 (11237 bp)

Fid Start End Size
(nt)		   Gap Find
best
clusters		 Pins Fc-sc SS Ev Function Aliases
2325 2362155 2360863 1293 -   46 1: 9   Protein translocase subunit SecY gene_name|secY, locus|SAUSA300_2184, protein_id|YP_494819.1, gi|87162195, geneID|3914838
2326 2362595 2362155 441 - -1 67 3: 1 3 2   LSU ribosomal protein L15p (L27Ae) gene_name|rplO, locus|SAUSA300_2185, protein_id|YP_494820.1, gi|87161362, geneID|3914761
2327 2362791 2362612 180 - 16 40 2: 3 2   LSU ribosomal protein L30p (L7e) gene_name|rpmD, locus|SAUSA300_2186, protein_id|YP_494821.1, gi|87162067, geneID|3914246
2328 2363308 2362808 501 - 16 74 4: 1 5 7 4   SSU ribosomal protein S5p (S2e) gene_name|rpsE, locus|SAUSA300_2187, protein_id|YP_494822.1, gi|87159908, geneID|3914954
2329 2363688 2363329 360 - 20 65 3: 1 3 2   LSU ribosomal protein L18p (L5e) gene_name|rplR, locus|SAUSA300_2188, protein_id|YP_494823.1, gi|87160596, geneID|3915215
2330 2364255 2363719 537 - 30 76 4: 1 3 2 4 dlit(17923494)
dlit(19289529)		 LSU ribosomal protein L6p (L9e) gene_name|rplF, locus|SAUSA300_2189, protein_id|YP_494824.1, gi|87160935, geneID|3914373
2331 2364678 2364280 399 - 24 70 2: 1 5   SSU ribosomal protein S8p (S15Ae) gene_name|rpsH, locus|SAUSA300_2190, protein_id|YP_494825.1, gi|87162226, geneID|3914001
2332 2364895 2364710 186 - 31 63 2: 5 6   SSU ribosomal protein S14p (S29e) @ SSU ribosomal protein S14p (S29e), zinc-dependent gene_name|rpsN, locus|SAUSA300_2191, protein_id|YP_494826.2, gi|162138571, geneID|3914991
2333 2365457 2364918 540 - 22 64 4: 1 3 2 4   LSU ribosomal protein L5p (L11e) gene_name|rplE, locus|SAUSA300_2192, protein_id|YP_494827.1, gi|87160361, geneID|3913235
2334 2365801 2365484 318 - 26 62 3: 1 3 2   LSU ribosomal protein L24p (L26e) gene_name|rplX, locus|SAUSA300_2193, protein_id|YP_494828.1, gi|87161395, geneID|3914165
2335 2366205 2365837 369 - 35 54 4: 1 3 2 4   LSU ribosomal protein L14p (L23e) gene_name|rplN, locus|SAUSA300_2194, protein_id|YP_494829.1, gi|87162129, geneID|3913593
2336 2366500 2366237 264 - 31 82 2: 1 5   SSU ribosomal protein S17p (S11e) gene_name|rpsQ, locus|SAUSA300_2195, protein_id|YP_494830.1, gi|87160555, geneID|3913510
2337 2366733 2366524 210 - 23 49 3: 1 3 2   LSU ribosomal protein L29p (L35e) gene_name|rpmC, locus|SAUSA300_2196, protein_id|YP_494831.1, gi|87161481, geneID|3914223
2338 2367157 2366723 435 - -11   4: 1 3 2 4   LSU ribosomal protein L16p (L10e) gene_name|rplP, locus|SAUSA300_2197, protein_id|YP_494832.1, gi|87162332, geneID|3913816
2339 2367813 2367160 654 - 2 61 3: 1 5 4   SSU ribosomal protein S3p (S3e) gene_name|rpsC, locus|SAUSA300_2198, protein_id|YP_494833.1, gi|87160014, geneID|3912925
2340 2368190 2367837 354 - 23 62 3: 1 3 2   LSU ribosomal protein L22p (L17e) gene_name|rplV, locus|SAUSA300_2199, protein_id|YP_494834.1, gi|87160513, geneID|3914725
2341 2368497 2368219 279 - 28 46 3: 1 5 4   SSU ribosomal protein S19p (S15e) gene_name|rpsS, locus|SAUSA300_2200, protein_id|YP_494835.1, gi|87162298, geneID|3913607
2342 2369397 2368564 834 - 66 58 4: 1 3 2 4   LSU ribosomal protein L2p (L8e) gene_name|rplB, locus|SAUSA300_2201, protein_id|YP_494836.1, gi|87162334, geneID|3913818
2343 2369705 2369430 276 - 32 73 3: 1 3 2   LSU ribosomal protein L23p (L23Ae) gene_name|rplW, locus|SAUSA300_2202, protein_id|YP_494837.1, gi|87160873, geneID|3914145
2344 2370328 2369705 624 - -1 59 4: 1 3 2 4   LSU ribosomal protein L4p (L1e) gene_name|rplD, locus|SAUSA300_2203, protein_id|YP_494838.1, gi|87160155, geneID|3913125
2345 2371017 2370355 663 - 26 67 5: 1 3 2 8 4   LSU ribosomal protein L3p (L3e) gene_name|rplC, locus|SAUSA300_2204, protein_id|YP_494839.1, gi|87161988, geneID|3914885
2346 2371353 2371045 309 - 27 42 3: 1 5 4   SSU ribosomal protein S10p (S20e) gene_name|rpsJ, locus|SAUSA300_2205, protein_id|YP_494840.1, gi|87162279, geneID|3915319
2347 2371710 2372099 390 + 356         Hypothetical protein SAV2252 locus|SAUSA300_2206, protein_id|YP_494841.1, gi|87160085, geneID|3914918

Annotation History   /   View All Related Annotations Help on Annotations


  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Ribospme_LSU_Symbiont vcrecy LSU ribosomal protein L16p (L10e)
Ribosome_LSU_bacterial gjo LSU ribosomal protein L16p (L10e)
Single-copy_ribosomal_proteins gjo LSU ribosomal protein L16p (L10e)
PanGenomes_ForPhylogeny_Str Ravcheev_Dmitry_user LSU ribosomal protein L16p (L10e)


  Protein Sequence

>fig|451515.3.peg.2338 LSU ribosomal protein L16p (L10e)
MLLPKRVKYRRQHRPKTTGRSKGGNYVTFGEFGLQATTTSWITSRQIESARIAMTRYMKR
GGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPGRILFEVAGVSEEVAREALRL
ASHKLPVKTKFVKREELGGETNES

MD5 = 74ff392005ad3cf40c89671ab9095900


  DNA Sequence

>fig|451515.3.peg.2338 LSU ribosomal protein L16p (L10e)
atgttactaccaaaacgtgtaaaatatcgtcgtcaacatcgtcctaaaacaactggtcgt
tctaaaggcggtaactacgtaacatttggtgagtttggtttacaagctacaacaacgtct
tggatcacatctcgtcaaatcgaatctgctcgtatagcaatgacacgttacatgaaacgt
ggcgggaaagtttggattaaaatcttcccacatacaccatatactaaaaaacctttagaa
gtacgtatgggtgctggtaaaggtgcggttgaaggctggatcgcagttgttaaaccaggt
agaattttattcgaagttgctggcgtttctgaagaagttgcgcgtgaagcactacgttta
gcaagtcacaaacttccagtaaaaactaagtttgtaaaacgtgaggaattgggtggtgaa
acaaatgaaagctaa


  DNA with Flanking Sequence

>fig|451515.3.peg.2338 LSU ribosomal protein L16p (L10e)
cacgtagagattgaacgtgctgcaaaccgtatcaacattgcaattcatactggtaaacct
ggtatggtaattggtaaaggcggttcagaaatcgaaaaattacgcaacaaattaaatgcg
ttaactgataaaaaagtacacatcaacgtaattgaaatcaaaaaagttgatcttgacgct
cgtttagtagctgaaaacatcgcacgtcaattagaaaaccgtgcttcattccgtcgtgta
caaaaacaagcaatcactagagctatgaaacttggtgctaaaggtatcaaaactcaagta
tctggtcgtttaggcggagctgacatcgctcgtgctgaacaatattcagaaggaactgtt
ccacttcatacgttacgtgctgacatcgattatgcacacgctgaagctgacactacttac
ggtaaattaggcgttaaagtatggatttatcgtggagaagttcttcctactaagaacact
agtggaggaggaaaataataatgttactaccaaaacgtgtaaaatatcgtcgtcaacatc
gtcctaaaacaactggtcgttctaaaggcggtaactacgtaacatttggtgagtttggtt
tacaagctacaacaacgtcttggatcacatctcgtcaaatcgaatctgctcgtatagcaa
tgacacgttacatgaaacgtggcgggaaagtttggattaaaatcttcccacatacaccat
atactaaaaaacctttagaagtacgtatgggtgctggtaaaggtgcggttgaaggctgga
tcgcagttgttaaaccaggtagaattttattcgaagttgctggcgtttctgaagaagttg
cgcgtgaagcactacgtttagcaagtcacaaacttccagtaaaaactaagtttgtaaaac
gtgaggaattgggtggtgaaacaaatgaaagctaaggaaattagagacttaaccacttca
gaaatcgaagaacaaatcaaatcttcaaaagaagagctttttaacctacgctttcagtta
gctacaggtcaattagaagaaactgcacgtattcgtacagtaagaaaaacgattgcacgt
ctaaaaactgttgctcgtgaaagagaaattgaacaaagtaaggctaatcaataattaagt
aagaggaggttacaaaagtgagcgaaagaaacgatcgtaaagtttatgtaggtaaagttg
tttcagacaaaatggacaagactattacagtacttgttgaaacttacaaaacacacaaat
tatacggtaaacgagtaaaatactctaaaaaatacaaaactcatgatgaaaacaattcag
ctaaattaggagacattgttaaaattcaagaaactcgtcctttatcagcaacaaaacgtt
ttcgtttagtagagattgttgaagagtcagtaattatttaatacaagtttagaga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0000049       F:tRNA binding
GO:0003735       F:structural constituent of ribosome
GO:0005840       C:ribosome
GO:0006412       P:translation
GO:0019843       F:rRNA binding
cmr|NT01SA2252 Staphylococcus aureus N315     ribosomal protein L16
cmr|NT02SA2249 Staphylococcus aureus Mu50     ribosomal protein L16
cmr|NT03SA2333 Staphylococcus aureus MW2     ribosomal protein L16
cmr|NT05SA2258 Staphylococcus aureus NCTC 8325     ribosomal protein L16
cmr|NT08SA2302 Staphylococcus aureus subsp. aureus MRSA252     ribosomal protein L16
cmr|NT09SA2150 Staphylococcus aureus subsp. aureus MSSA476     ribosomal protein L16
cmr|NT11SA2125 Staphylococcus aureus RF122     ribosomal protein L16
cmr|SACOL2232 Staphylococcus aureus subsp. aureus COL     ribosomal protein L16
cmr|SAUSA300_2197 Staphylococcus aureus subsp. aureus USA300-FPR3757     50S ribosomal protein L16
dbj|BAB43335.1 Staphylococcus aureus subsp. aureus N315     50S ribosomal protein L16
dbj|BAB58405.1 Staphylococcus aureus subsp. aureus Mu50     50S ribosomal protein L16
dbj|BAB96027.1 Staphylococcus aureus subsp. aureus MW2     50S ribosomal protein L16
dbj|BAF68417.1 Staphylococcus aureus subsp. aureus str. Newman     50S ribosomal protein L16
dbj|BAF79110.1 Staphylococcus aureus subsp. aureus Mu3     50S ribosomal protein L16
emb|CAG41309.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   50S ribosomal protein L16
emb|CAG43945.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   50S ribosomal protein L16
emb|CAI81804.1 Staphylococcus aureus RF122 EMBL   50S ribosomal protein L16
fig|158878.1.peg.2243 Staphylococcus aureus subsp. aureus Mu50 FIG   LSU ribosomal protein L16p (L10e)
fig|158878.14.peg.2318 Staphylococcus aureus subsp. aureus Mu50 FIG   LSU ribosomal protein L16p (L10e)
fig|158879.1.peg.2118 Staphylococcus aureus subsp. aureus N315 FIG   LSU ribosomal protein L16p (L10e)
fig|158879.11.peg.2209 Staphylococcus aureus subsp. aureus N315 FIG   LSU ribosomal protein L16p (L10e)
fig|196620.1.peg.2162 Staphylococcus aureus subsp. aureus MW2 FIG   LSU ribosomal protein L16p (L10e)
fig|196620.5.peg.2233 Staphylococcus aureus subsp. aureus MW2 FIG   LSU ribosomal protein L16p (L10e)
fig|273036.3.peg.2069 Staphylococcus aureus RF122 FIG   LSU ribosomal protein L16p (L10e)
fig|273036.6.peg.2228 Staphylococcus aureus RF122 FIG   LSU ribosomal protein L16p (L10e)
fig|282458.1.peg.2200 Staphylococcus aureus subsp. aureus MRSA252 FIG   LSU ribosomal protein L16p (L10e)
fig|282458.4.peg.2340 Staphylococcus aureus subsp. aureus MRSA252 FIG   LSU ribosomal protein L16p (L10e)
fig|282459.1.peg.2112 Staphylococcus aureus subsp. aureus MSSA476 FIG   LSU ribosomal protein L16p (L10e)
fig|282459.5.peg.2218 Staphylococcus aureus subsp. aureus MSSA476 FIG   LSU ribosomal protein L16p (L10e)
fig|359786.13.peg.2398 Staphylococcus aureus subsp. aureus JH9 FIG   LSU ribosomal protein L16p (L10e)
fig|359786.3.peg.1751 Staphylococcus aureus subsp. aureus JH9 FIG   LSU ribosomal protein L16p (L10e)
fig|359787.11.peg.2361 Staphylococcus aureus subsp. aureus JH1 FIG   LSU ribosomal protein L16p (L10e)
fig|367830.3.peg.1612 Staphylococcus aureus subsp. aureus USA300 FIG   LSU ribosomal protein L16p (L10e)
fig|418127.4.peg.2061 Staphylococcus aureus subsp. aureus Mu3 FIG   LSU ribosomal protein L16p (L10e)
fig|418127.6.peg.2283 Staphylococcus aureus subsp. aureus Mu3 FIG   LSU ribosomal protein L16p (L10e)
fig|426430.6.peg.2084 Staphylococcus aureus subsp. aureus str. Newman FIG   LSU ribosomal protein L16p (L10e)
fig|426430.8.peg.2332 Staphylococcus aureus subsp. aureus str. Newman FIG   LSU ribosomal protein L16p (L10e)
fig|450394.6.peg.1451 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   LSU ribosomal protein L16p (L10e)
fig|451516.9.peg.2327 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   LSU ribosomal protein L16p (L10e)
fig|452948.4.peg.1134 Staphylococcus aureus 930918-3 FIG   LSU ribosomal protein L16p (L10e)
fig|455227.3.peg.462 Staphylococcus aureus D30 FIG   LSU ribosomal protein L16p (L10e)
fig|505321.3.peg.2572 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   LSU ribosomal protein L16p (L10e)
fig|546342.3.peg.1987 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   LSU ribosomal protein L16p (L10e)
fig|546343.3.peg.161 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   LSU ribosomal protein L16p (L10e)
fig|548470.3.peg.1110 Staphylococcus aureus subsp. aureus MN8 FIG   LSU ribosomal protein L16p (L10e)
fig|548473.3.peg.356 Staphylococcus aureus subsp. aureus TCH60 FIG   LSU ribosomal protein L16p (L10e)
fig|548474.3.peg.639 Staphylococcus aureus subsp. aureus TCH130 FIG   LSU ribosomal protein L16p (L10e)
fig|548475.3.peg.1930 Staphylococcus aureus subsp. aureus TCH70 FIG   LSU ribosomal protein L16p (L10e)
fig|553565.3.peg.2167 Staphylococcus aureus A5937 FIG   LSU ribosomal protein L16p (L10e)
fig|553567.3.peg.254 Staphylococcus aureus A5948 FIG   LSU ribosomal protein L16p (L10e)
fig|553568.3.peg.2567 Staphylococcus aureus A6224 FIG   LSU ribosomal protein L16p (L10e)
fig|553571.3.peg.1691 Staphylococcus aureus A6300 FIG   LSU ribosomal protein L16p (L10e)
fig|553573.3.peg.628 Staphylococcus aureus A8115 FIG   LSU ribosomal protein L16p (L10e)
fig|553574.3.peg.1026 Staphylococcus aureus A8117 FIG   LSU ribosomal protein L16p (L10e)
fig|553577.3.peg.64 Staphylococcus aureus A8796 FIG   LSU ribosomal protein L16p (L10e)
fig|553580.3.peg.66 Staphylococcus aureus A8819 FIG   LSU ribosomal protein L16p (L10e)
fig|553581.3.peg.2657 Staphylococcus aureus A9299 FIG   LSU ribosomal protein L16p (L10e)
fig|553583.3.peg.205 Staphylococcus aureus A9635 FIG   LSU ribosomal protein L16p (L10e)
fig|553588.3.peg.2746 Staphylococcus aureus A9719 FIG   LSU ribosomal protein L16p (L10e)
fig|553590.4.peg.841 Staphylococcus aureus A9754 FIG   LSU ribosomal protein L16p (L10e)
fig|553592.3.peg.1107 Staphylococcus aureus A9763 FIG   LSU ribosomal protein L16p (L10e)
fig|553594.3.peg.1123 Staphylococcus aureus A9765 FIG   LSU ribosomal protein L16p (L10e)
fig|553596.3.peg.1484 Staphylococcus aureus A9781 FIG   LSU ribosomal protein L16p (L10e)
fig|553601.3.peg.466 Staphylococcus aureus A10102 FIG   LSU ribosomal protein L16p (L10e)
fig|585143.3.peg.383 Staphylococcus aureus subsp. aureus 55/2053 FIG   LSU ribosomal protein L16p (L10e)
fig|585144.3.peg.693 Staphylococcus aureus subsp. aureus 58-424 FIG   LSU ribosomal protein L16p (L10e)
fig|585145.3.peg.503 Staphylococcus aureus subsp. aureus 65-1322 FIG   LSU ribosomal protein L16p (L10e)
fig|585146.3.peg.74 Staphylococcus aureus subsp. aureus 68-397 FIG   LSU ribosomal protein L16p (L10e)
fig|585147.3.peg.1793 Staphylococcus aureus subsp. aureus A017934/97 FIG   LSU ribosomal protein L16p (L10e)
fig|585148.3.peg.2017 Staphylococcus aureus subsp. aureus Btn1260 FIG   LSU ribosomal protein L16p (L10e)
fig|585149.6.peg.2411 Staphylococcus aureus subsp. aureus C101 FIG   LSU ribosomal protein L16p (L10e)
fig|585150.3.peg.626 Staphylococcus aureus subsp. aureus C160 FIG   LSU ribosomal protein L16p (L10e)
fig|585151.3.peg.1953 Staphylococcus aureus subsp. aureus C427 FIG   LSU ribosomal protein L16p (L10e)
fig|585152.3.peg.2213 Staphylococcus aureus subsp. aureus D139 FIG   LSU ribosomal protein L16p (L10e)
fig|585153.3.peg.506 Staphylococcus aureus subsp. aureus E1410 FIG   LSU ribosomal protein L16p (L10e)
fig|585154.3.peg.2298 Staphylococcus aureus subsp. aureus EMRSA16 FIG   LSU ribosomal protein L16p (L10e)
fig|585155.3.peg.781 Staphylococcus aureus subsp. aureus H19 FIG   LSU ribosomal protein L16p (L10e)
fig|585156.3.peg.1790 Staphylococcus aureus subsp. aureus M1015 FIG   LSU ribosomal protein L16p (L10e)
fig|585157.3.peg.1907 Staphylococcus aureus subsp. aureus M809 FIG   LSU ribosomal protein L16p (L10e)
fig|585158.3.peg.284 Staphylococcus aureus subsp. aureus M876 FIG   LSU ribosomal protein L16p (L10e)
fig|585159.3.peg.2339 Staphylococcus aureus subsp. aureus M899 FIG   LSU ribosomal protein L16p (L10e)
fig|585160.3.peg.2048 Staphylococcus aureus subsp. aureus WBG10049 FIG   LSU ribosomal protein L16p (L10e)
fig|585161.3.peg.2069 Staphylococcus aureus subsp. aureus WW2703/97 FIG   LSU ribosomal protein L16p (L10e)
fig|585891.3.peg.2314 Staphylococcus aureus subsp. aureus Mu50-omega FIG   LSU ribosomal protein L16p (L10e)
fig|644279.4.peg.2379 Staphylococcus aureus subsp. aureus 132 FIG   LSU ribosomal protein L16p (L10e)
fig|680649.3.peg.1316 Staphylococcus aureus subsp. aureus MR1 FIG   LSU ribosomal protein L16p (L10e)
fig|681288.4.peg.2261 Staphylococcus aureus subsp. aureus ED98 FIG   LSU ribosomal protein L16p (L10e)
fig|703339.3.peg.2224 Staphylococcus aureus 04-02981 FIG   LSU ribosomal protein L16p (L10e)
fig|762962.3.peg.2275 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   LSU ribosomal protein L16p (L10e)
fig|93061.3.peg.2364 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   LSU ribosomal protein L16p (L10e)
fig|93061.5.peg.2260 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   LSU ribosomal protein L16p (L10e)
fig|93062.19.peg.2177 Staphylococcus aureus subsp. aureus COL FIG   LSU ribosomal protein L16p (L10e)
fig|93062.4.peg.2287 Staphylococcus aureus subsp. aureus COL FIG   LSU ribosomal protein L16p (L10e)
gb|AAW37107.1 Staphylococcus aureus subsp. aureus COL     ribosomal protein L16
gb|ABD22820.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     50S ribosomal protein L16
gb|ABD31523.1 Staphylococcus aureus subsp. aureus NCTC 8325     ribosomal protein L16
gb|ABQ50050.1 Staphylococcus aureus subsp. aureus JH9     LSU ribosomal protein L16P
gb|ABR53136.1 Staphylococcus aureus subsp. aureus JH1     ribosomal protein L16
gb|EEI96543.1 Staphylococcus aureus subsp. aureus MN8     50S ribosomal protein L16
gb|EEJ62537.1 Staphylococcus aureus subsp. aureus TCH60     50S ribosomal protein L16
gb|EES55760.1 Staphylococcus aureus subsp. aureus TCH70     50S ribosomal protein L16
gb|EES95085.1 Staphylococcus aureus subsp. aureus USA300_TCH959     50S ribosomal protein L16
gb|EES96394.1 Staphylococcus aureus subsp. aureus TCH130     50S ribosomal protein L16
gb|EEV04848.1 Staphylococcus aureus subsp. aureus 55/2053     LSU ribosomal protein L16P
gb|EEV07488.1 Staphylococcus aureus subsp. aureus 65-1322     ribosomal protein L16
gb|EEV10113.1 Staphylococcus aureus subsp. aureus 68-397     ribosomal protein L16
gb|EEV12702.1 Staphylococcus aureus subsp. aureus E1410     ribosomal protein L16
gb|EEV15364.1 Staphylococcus aureus subsp. aureus M876     LSU ribosomal protein L16
gb|EEV26901.1 Staphylococcus aureus A9781     50S ribosomal protein L16
gb|EEV64952.1 Staphylococcus aureus A9763     50S ribosomal protein L16
gb|EEV66276.1 Staphylococcus aureus A9719     LSU ribosomal protein L16
gb|EEV71110.1 Staphylococcus aureus A9635     LSU ribosomal protein L16
gb|EEV71575.1 Staphylococcus aureus A9299     LSU ribosomal protein L16P
gb|EEV75702.1 Staphylococcus aureus A8115     ribosomal protein L16
gb|EEV77670.1 Staphylococcus aureus A6300     50S ribosomal protein L16
gb|EEV79229.1 Staphylococcus aureus A6224     ribosomal protein L16
gb|EEV84347.1 Staphylococcus aureus A5948     ribosomal protein L16
gb|EEV85379.1 Staphylococcus aureus A5937     50S ribosomal protein L16
gb|EEW45120.1 Staphylococcus aureus 930918-3     50S ribosomal protein L16
gb|EEW47923.1 Staphylococcus aureus D30     50S ribosomal protein L16
gi|115502795 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L16
gi|115502796 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L16
gi|115502797 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L16
gi|13702043 Staphylococcus aureus subsp. aureus N315 NCBI   50S ribosomal protein L16
gi|14248016 Staphylococcus aureus subsp. aureus Mu50 NCBI   50S ribosomal protein L16
gi|147741752 Staphylococcus aureus subsp. aureus JH9 NCBI   LSU ribosomal protein L16P
gi|148268683 Staphylococcus aureus subsp. aureus JH9 NCBI   50S ribosomal protein L16
gi|149947200 Staphylococcus aureus subsp. aureus JH1 NCBI   ribosomal protein L16
gi|150375157 Staphylococcus aureus subsp. aureus str. Newman NCBI   50S ribosomal protein L16
gi|150394748 Staphylococcus aureus subsp. aureus JH1 NCBI   50S ribosomal protein L16
gi|151222357 Staphylococcus aureus subsp. aureus str. Newman NCBI   50S ribosomal protein L16
gi|156722693 Staphylococcus aureus subsp. aureus Mu3 NCBI   50S ribosomal protein L16
gi|156980558 Staphylococcus aureus subsp. aureus Mu3 NCBI   50S ribosomal protein L16
gi|15925233 Staphylococcus aureus subsp. aureus Mu50 NCBI   50S ribosomal protein L16
gi|15927823 Staphylococcus aureus subsp. aureus N315 NCBI   50S ribosomal protein L16
gi|166216112 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L16
gi|172049019 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L16
gi|189041486 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L16
gi|189041487 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L16
gi|21205333 Staphylococcus aureus subsp. aureus MW2 NCBI   50S ribosomal protein L16
gi|21283891 Staphylococcus aureus subsp. aureus MW2 NCBI   50S ribosomal protein L16
gi|221138945 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   50S ribosomal protein L16
gi|221140155 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   50S ribosomal protein L16
gi|227246784 Staphylococcus aureus subsp. aureus MN8 NCBI   50S ribosomal protein L16
gi|227556926 Staphylococcus aureus subsp. aureus MN8 NCBI   50S ribosomal protein L16
gi|227852739 Staphylococcus aureus subsp. aureus TCH60 NCBI   50S ribosomal protein L16
gi|227898986 Staphylococcus aureus subsp. aureus TCH60 NCBI   50S ribosomal protein L16
gi|251803103 Staphylococcus aureus subsp. aureus TCH70 NCBI   50S ribosomal protein L16
gi|251813330 Staphylococcus aureus subsp. aureus TCH70 NCBI   50S ribosomal protein L16
gi|253317003 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   50S ribosomal protein L16
gi|253726356 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   50S ribosomal protein L16
gi|253727665 Staphylococcus aureus subsp. aureus TCH130 NCBI   50S ribosomal protein L16
gi|253729909 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   50S ribosomal protein L16
gi|253734348 Staphylococcus aureus subsp. aureus TCH130 NCBI   50S ribosomal protein L16
gi|255007023 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   50S ribosomal protein L16
gi|257272746 Staphylococcus aureus subsp. aureus 55/2053 NCBI   LSU ribosomal protein L16P
gi|257276037 Staphylococcus aureus subsp. aureus 65-1322 NCBI   ribosomal protein L16
gi|257279526 Staphylococcus aureus subsp. aureus 68-397 NCBI   ribosomal protein L16
gi|257282570 Staphylococcus aureus subsp. aureus E1410 NCBI   ribosomal protein L16
gi|257285248 Staphylococcus aureus subsp. aureus M876 NCBI   LSU ribosomal protein L16
gi|257423728 Staphylococcus aureus subsp. aureus 55/2053 NCBI   LSU ribosomal protein L16P
gi|257426406 Staphylococcus aureus subsp. aureus 65-1322 NCBI   ribosomal protein L16
gi|257429045 Staphylococcus aureus subsp. aureus 68-397 NCBI   ribosomal protein L16
gi|257431691 Staphylococcus aureus subsp. aureus E1410 NCBI   ribosomal protein L16
gi|257434652 Staphylococcus aureus subsp. aureus M876 NCBI   LSU ribosomal protein L16
gi|257788561 Staphylococcus aureus A9781 NCBI   50S ribosomal protein L16
gi|257794589 Staphylococcus aureus A9781 NCBI   50S ribosomal protein L16
gi|257840492 Staphylococcus aureus A9763 NCBI   50S ribosomal protein L16
gi|257841839 Staphylococcus aureus A9719 NCBI   LSU ribosomal protein L16
gi|257847101 Staphylococcus aureus A9635 NCBI   LSU ribosomal protein L16
gi|257847573 Staphylococcus aureus A9299 NCBI   LSU ribosomal protein L16P
gi|257851768 Staphylococcus aureus A8115 NCBI   ribosomal protein L16
gi|257854722 Staphylococcus aureus A6300 NCBI   50S ribosomal protein L16
gi|257856320 Staphylococcus aureus A6224 NCBI   ribosomal protein L16
gi|257861545 Staphylococcus aureus A5948 NCBI   ribosomal protein L16
gi|257862611 Staphylococcus aureus A5937 NCBI   50S ribosomal protein L16
gi|258408809 Staphylococcus aureus A9763 NCBI   50S ribosomal protein L16
gi|258422408 Staphylococcus aureus A9719 NCBI   LSU ribosomal protein L16
gi|258422690 Staphylococcus aureus A9635 NCBI   LSU ribosomal protein L16
gi|258439797 Staphylococcus aureus A9299 NCBI   LSU ribosomal protein L16P
gi|258442647 Staphylococcus aureus A8115 NCBI   ribosomal protein L16
gi|258446654 Staphylococcus aureus A6300 NCBI   50S ribosomal protein L16
gi|258450228 Staphylococcus aureus A6224 NCBI   ribosomal protein L16
gi|258450762 Staphylococcus aureus A5948 NCBI   ribosomal protein L16
gi|258455400 Staphylococcus aureus A5937 NCBI   50S ribosomal protein L16
gi|259160087 Staphylococcus aureus 930918-3 NCBI   50S ribosomal protein L16
gi|259163365 Staphylococcus aureus D30 NCBI   50S ribosomal protein L16
gi|49242588 Staphylococcus aureus subsp. aureus MRSA252 NCBI   50S ribosomal protein L16
gi|49245468 Staphylococcus aureus subsp. aureus MSSA476 NCBI   50S ribosomal protein L16
gi|49484459 Staphylococcus aureus subsp. aureus MRSA252 NCBI   50S ribosomal protein L16
gi|49487025 Staphylococcus aureus subsp. aureus MSSA476 NCBI   50S ribosomal protein L16
gi|57285013 Staphylococcus aureus subsp. aureus COL NCBI   ribosomal protein L16
gi|57650827 Staphylococcus aureus subsp. aureus COL NCBI   50S ribosomal protein L16
gi|81648831 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L16
gi|81650583 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L16
gi|81693964 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L16
gi|81704219 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L16
gi|81705247 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L16
gi|81781099 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L16
gi|82657363 Staphylococcus aureus RF122 NCBI   50S ribosomal protein L16
gi|82751832 Staphylococcus aureus RF122 NCBI   50S ribosomal protein L16
gi|87128306 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   50S ribosomal protein L16
gi|87162332 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   50S ribosomal protein L16
gi|87203713 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   ribosomal protein L16
gi|88196155 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   50S ribosomal protein L16
img|637093786 Staphylococcus aureus aureus N315 IMG   50S ribosomal protein L16
img|637100800 Staphylococcus aureus aureus Mu50 IMG   50S ribosomal protein L16
img|637152995 Staphylococcus aureus aureus COL IMG   50S ribosomal protein L16
img|637155761 Staphylococcus aureus aureus MRSA252 IMG   50S ribosomal protein L16
img|637158403 Staphylococcus aureus aureus MSSA476 IMG   50S ribosomal protein L16
img|637299979 Staphylococcus aureus aureus MW2 IMG   50S ribosomal protein L16
img|637817097 Staphylococcus aureus RF122 IMG   50S ribosomal protein L16
img|637888840 Staphylococcus aureus aureus USA300 IMG   50S ribosomal protein L16
img|637895121 Staphylococcus aureus aureus NCTC 8325 IMG   ribosomal protein L16
img|640566658 Staphylococcus aureus aureus JH9 IMG   ribosomal protein L16
img|640780423 Staphylococcus aureus aureus JH1 IMG   ribosomal protein L16
img|640796576 Staphylococcus aureus aureus Newman IMG   50S ribosomal protein L16
img|640905025 Staphylococcus aureus aureus Mu3 IMG   50S ribosomal protein L16
img|641772598 Staphylococcus aureus aureus USA300_TCH959 IMG   50S ribosomal protein L16
kegg|saa:SAUSA300_2197 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   50S ribosomal protein L16
kegg|sab:SAB2115c Staphylococcus aureus RF122 KEGG   50S ribosomal protein L16
kegg|sac:SACOL2232 Staphylococcus aureus subsp. aureus COL KEGG   50S ribosomal protein L16
kegg|sae:NWMN_2145 Staphylococcus aureus subsp. aureus Newman KEGG   50S ribosomal protein L16
kegg|sah:SaurJH1_2311 Staphylococcus aureus subsp. aureus JH1 KEGG   50S ribosomal protein L16
kegg|saj:SaurJH9_2270 Staphylococcus aureus subsp. aureus JH9 KEGG   50S ribosomal protein L16
kegg|sam:MW2162 Staphylococcus aureus subsp. aureus MW2 KEGG   50S ribosomal protein L16
kegg|sao:SAOUHSC_02505 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   50S ribosomal protein L16
kegg|sar:SAR2328   KEGG   50S ribosomal protein L16
kegg|sas:SAS2134   KEGG   50S ribosomal protein L16
kegg|sau:SA2040   KEGG   50S ribosomal protein L16
kegg|sav:SAV2243   KEGG   50S ribosomal protein L16
kegg|saw:SAHV_2227 Staphylococcus aureus subsp. aureus Mu3 KEGG   50S ribosomal protein L16
ref|NP_372767.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   50S ribosomal protein L16
ref|NP_375356.1 Staphylococcus aureus subsp. aureus N315 RefSeq   50S ribosomal protein L16
ref|NP_646979.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   50S ribosomal protein L16
ref|YP_001247626.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   50S ribosomal protein L16
ref|YP_001317423.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   50S ribosomal protein L16
ref|YP_001333179.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   50S ribosomal protein L16
ref|YP_001442817.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   50S ribosomal protein L16
ref|YP_041683.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   50S ribosomal protein L16
ref|YP_044246.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   50S ribosomal protein L16
ref|YP_187042.1 Staphylococcus aureus subsp. aureus COL RefSeq   50S ribosomal protein L16
ref|YP_417573.1 Staphylococcus aureus RF122 RefSeq   50S ribosomal protein L16
ref|YP_494832.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   50S ribosomal protein L16
ref|YP_500972.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   50S ribosomal protein L16
ref|ZP_03563746.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   50S ribosomal protein L16
ref|ZP_03564648.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   50S ribosomal protein L16
ref|ZP_03986973.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   50S ribosomal protein L16
ref|ZP_04016791.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   50S ribosomal protein L16
ref|ZP_04827803.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   50S ribosomal protein L16
ref|ZP_04840216.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   50S ribosomal protein L16
ref|ZP_04864074.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   50S ribosomal protein L16
ref|ZP_04868513.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   50S ribosomal protein L16
ref|ZP_05145624.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   50S ribosomal protein L16
ref|ZP_05600157.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   LSU ribosomal protein L16P
ref|ZP_05602808.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   ribosomal protein L16
ref|ZP_05605432.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   ribosomal protein L16
ref|ZP_05608054.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   ribosomal protein L16
ref|ZP_05610703.1 Staphylococcus aureus subsp. aureus M876 RefSeq   LSU ribosomal protein L16
ref|ZP_05643568.1 Staphylococcus aureus A9781 RefSeq   50S ribosomal protein L16
ref|ZP_05681093.1 Staphylococcus aureus A9763 RefSeq   50S ribosomal protein L16
ref|ZP_05685320.1 Staphylococcus aureus A9719 RefSeq   LSU ribosomal protein L16
ref|ZP_05685595.1 Staphylococcus aureus A9635 RefSeq   LSU ribosomal protein L16
ref|ZP_05690543.1 Staphylococcus aureus A9299 RefSeq   LSU ribosomal protein L16P
ref|ZP_05691207.1 Staphylococcus aureus A8115 RefSeq   ribosomal protein L16
ref|ZP_05694809.1 Staphylococcus aureus A6300 RefSeq   50S ribosomal protein L16
ref|ZP_05698320.1 Staphylococcus aureus A6224 RefSeq   ribosomal protein L16
ref|ZP_05698821.1 Staphylococcus aureus A5948 RefSeq   ribosomal protein L16
ref|ZP_05703360.1 Staphylococcus aureus A5937 RefSeq   50S ribosomal protein L16
sp|A5IV27 Staphylococcus aureus (strain JH9) SwissProt   50S ribosomal protein L16
sp|A6QJ85 Staphylococcus aureus (strain Newman) SwissProt   50S ribosomal protein L16
sp|A6U3W8 Staphylococcus aureus (strain JH1) SwissProt   50S ribosomal protein L16
sp|A7X5F4 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   50S ribosomal protein L16
sp|Q2FEP6 Staphylococcus aureus (strain USA300) SwissProt   50S ribosomal protein L16
sp|Q2FW13 Staphylococcus aureus (strain NCTC 8325) SwissProt   50S ribosomal protein L16
sp|Q2YYQ3 Staphylococcus aureus (strain bovine RF122 / ET3-1) SwissProt   50S ribosomal protein L16
sp|Q5HDW5 Staphylococcus aureus (strain COL) SwissProt   50S ribosomal protein L16
sp|Q6G778 Staphylococcus aureus (strain MSSA476) SwissProt   50S ribosomal protein L16
sp|Q6GEJ0 Staphylococcus aureus (strain MRSA252) SwissProt   50S ribosomal protein L16
sp|Q7A080 Staphylococcus aureus (strain MW2) SwissProt   50S ribosomal protein L16
sp|Q7A461 Staphylococcus aureus (strain N315) SwissProt   50S ribosomal protein L16
sp|Q99S28 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   50S ribosomal protein L16
sp|RL16_STAA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L16
sp|RL16_STAA2 organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L16
sp|RL16_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L16
sp|RL16_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L16
sp|RL16_STAA9 organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L16
sp|RL16_STAAB organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L16
sp|RL16_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L16
sp|RL16_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L16
sp|RL16_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L16
sp|RL16_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L16
sp|RL16_STAAR organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L16
sp|RL16_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L16
sp|RL16_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L16
tr|C2G8V8 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   50S ribosomal protein L16
tr|C2K4D3 Staphylococcus aureus subsp. aureus MN8 TrEMBL   50S ribosomal protein L16
tr|C5MZA9 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   50S ribosomal protein L16
tr|C5Q2Z4 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   50S ribosomal protein L16
tr|C5QG87 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   50S ribosomal protein L16


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link

  Functional Coupling

Score Peg Function
46 fig|451515.3.peg.2325 Protein translocase subunit SecY
67 fig|451515.3.peg.2326 LSU ribosomal protein L15p (L27Ae)
40 fig|451515.3.peg.2327 LSU ribosomal protein L30p (L7e)
74 fig|451515.3.peg.2328 SSU ribosomal protein S5p (S2e)
65 fig|451515.3.peg.2329 LSU ribosomal protein L18p (L5e)
76 fig|451515.3.peg.2330 LSU ribosomal protein L6p (L9e)
70 fig|451515.3.peg.2331 SSU ribosomal protein S8p (S15Ae)
63 fig|451515.3.peg.2332 SSU ribosomal protein S14p (S29e) @ SSU ribosomal protein S14p (S29e), zinc-dependent
64 fig|451515.3.peg.2333 LSU ribosomal protein L5p (L11e)
62 fig|451515.3.peg.2334 LSU ribosomal protein L24p (L26e)
54 fig|451515.3.peg.2335 LSU ribosomal protein L14p (L23e)
82 fig|451515.3.peg.2336 SSU ribosomal protein S17p (S11e)
49 fig|451515.3.peg.2337 LSU ribosomal protein L29p (L35e)
61 fig|451515.3.peg.2339 SSU ribosomal protein S3p (S3e)
62 fig|451515.3.peg.2340 LSU ribosomal protein L22p (L17e)
46 fig|451515.3.peg.2341 SSU ribosomal protein S19p (S15e)
58 fig|451515.3.peg.2342 LSU ribosomal protein L2p (L8e)
73 fig|451515.3.peg.2343 LSU ribosomal protein L23p (L23Ae)
59 fig|451515.3.peg.2344 LSU ribosomal protein L4p (L1e)
67 fig|451515.3.peg.2345 LSU ribosomal protein L3p (L3e)
42 fig|451515.3.peg.2346 SSU ribosomal protein S10p (S20e)


  Attributes

Help on Attributes

Key
Link Explains Key		 Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer

Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options

|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions
FIG search