The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.2303: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: Truncated cell surface protein map-w
Translate Function Assignments



Context on contig NC_007793 from base 2338092 to 2348539 (10448 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2300 2338092 2340515 2424 +           Hyaluronate lyase precursor (EC 4.2.2.1) gene_name|hysA, locus|SAUSA300_2161, protein_id|YP_494797.1, gi|87161621, geneID|3913476
2301 2341273 2340575 699 - 59     1: 5   Peptidase, M23/M37 family locus|SAUSA300_2162, protein_id|YP_494798.1, gi|87160662, geneID|3913986
2302 2342455 2341640 816 - 366         Hydrolase (HAD superfamily) locus|SAUSA300_2163, protein_id|YP_494799.1, gi|87161752, geneID|3913897
2303 2342749 2343174 426 + 293     1: 1   Truncated cell surface protein map-w locus|SAUSA300_2164, protein_id|YP_494800.1, gi|87162347, geneID|3913831
2304 2344242 2343538 705 - 363     3: 1 3 2   alpha-acetolactate decarboxylase (EC 4.1.1.5) gene_name|budA, locus|SAUSA300_2165, protein_id|YP_494801.1, gi|87160350, geneID|3915125
2305 2345943 2344279 1665 - 36     4: 1 4 3 2   Acetolactate synthase, catabolic (EC 2.2.1.6) gene_name|alsS, locus|SAUSA300_2166, protein_id|YP_494802.1, gi|87160944, geneID|3913784
2306 2346579 2346397 183 - 453         Hypothetical protein MW2134  
2307 2348539 2347133 1407 - 553         conserved domain protein, putative locus|SAUSA300_2167, protein_id|YP_494803.1, gi|87160340, geneID|3915115

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Murein_hydrolase_regulation_and_cell_death VeronikaV *Truncated cell surface protein map-w


  Protein Sequence

>fig|451515.3.peg.2303 Truncated cell surface protein map-w
MKLKSFVTATLALGLLSTVGAALPSHEASADSNNGYKEMTVDGYHTVPYTISVDGITALH
RTYFIFPENKNVLYQEIDSKVKNELASQRGVTTEKINNAQTATYTLTLNDGNKKVVNLKK
NDDAKNSIDPSTIKQIQIVVK

MD5 = c60f4a79053b1c058aaea6a4ae5fc30a


  DNA Sequence

>fig|451515.3.peg.2303 Truncated cell surface protein map-w
atgaaactaaaatcatttgttactgccactttagcattgggattattatcaacggtcgga
gctgcattaccgagtcacgaagcatctgcagatagtaataacggctataaagaaatgact
gtggatggttatcacactgttccttacacaatttcagtagatggtattactgcattacat
cgaacttactttatcttcccagaaaataaaaatgttctttatcaagaaattgacagtaaa
gtaaaaaatgaattagcttctcaacgtggtgttacaacagaaaaaattaataatgcccaa
acagcaacttatacgcttactttgaatgatggtaataaaaaagtagtgaatctaaagaaa
aatgacgacgctaaaaattcaattgatccaagtacaatcaaacagatacaaattgtagtt
aaataa


  DNA with Flanking Sequence

>fig|451515.3.peg.2303 Truncated cell surface protein map-w
tggtttaaacgtcatattaacttgatccattttatccatgacactttgaaatgtacttcc
tgtcaatacagcagtgatcacttcattattattagttagtttttccaacaatttttccat
ttctcttaaatgacttaaatcttcttcatttgtattatgtttaaaatatgtttcatcaaa
atcaaacaataatagacgctttgacatactcattcccccataatattttaatgaatttat
ctataacttaaatacactataagtctcaattaaaagtataagatcgactatatgcttttc
atgattattatatacaactaatcaatccctataaactaaaaacattgcttaccacttttc
aaaatgcacgagtcatatccctcgttaaaaactattactaaaaattaaaatataaaaaat
gcaaaaagtatgttttaaactttatgaaacgtgttatacaaatagtgtaatatcatacaa
cccgaaaaggagattgagatatgaaactaaaatcatttgttactgccactttagcattgg
gattattatcaacggtcggagctgcattaccgagtcacgaagcatctgcagatagtaata
acggctataaagaaatgactgtggatggttatcacactgttccttacacaatttcagtag
atggtattactgcattacatcgaacttactttatcttcccagaaaataaaaatgttcttt
atcaagaaattgacagtaaagtaaaaaatgaattagcttctcaacgtggtgttacaacag
aaaaaattaataatgcccaaacagcaacttatacgcttactttgaatgatggtaataaaa
aagtagtgaatctaaagaaaaatgacgacgctaaaaattcaattgatccaagtacaatca
aacagatacaaattgtagttaaataataatttgaaaatagttttatagggcaagcgctga
aaaattggcgtttgtctttttagttattgaacttgtaaattattgttgtttgcttctcgt
agtaacagattggcctatacaatagtaaattttatatgagtgtgtaccacaatttataat
ctaaacataacagcaaatctcaaatatctggaacctaataaatcccctcactactgctaa
tagtgaagggatttattttattacttagacgtaattataaatatatttgttctattgtag
tcatggttaatcatatttacaaactatcatttctaaatcgcgcattatgaagtcaatttt
cataaaccgtcattatatttctggattcattattcagcttctctaatttcgtctgcaata
tctttatagtcaatatttgctttagtgaaatctttatcttgaattggaaaatgctgttca
aatgtttctatattttggatttctactttaacatcttctacttcaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA2224 Staphylococcus aureus NCTC 8325     MAP
cmr|SACOL2197 Staphylococcus aureus subsp. aureus COL     surface protein, putative
cmr|SAUSA300_2164 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAF68381.1 Staphylococcus aureus subsp. aureus str. Newman     truncated MHC class II analog protein
fig|367830.3.peg.1235 Staphylococcus aureus subsp. aureus USA300 FIG   Truncated cell surface protein map-w
fig|426430.6.peg.2049 Staphylococcus aureus subsp. aureus str. Newman FIG   Truncated cell surface protein map-w
fig|426430.8.peg.2296 Staphylococcus aureus subsp. aureus str. Newman FIG   Truncated cell surface protein map-w
fig|451516.9.peg.2292 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Truncated cell surface protein map-w
fig|452948.4.peg.1555 Staphylococcus aureus 930918-3 FIG   Truncated cell surface protein map-w
fig|455227.3.peg.426 Staphylococcus aureus D30 FIG   Truncated cell surface protein map-w
fig|546342.3.peg.1952 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Truncated cell surface protein map-w
fig|546343.3.peg.196 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Truncated cell surface protein map-w
fig|553567.3.peg.305 Staphylococcus aureus A5948 FIG   Truncated cell surface protein map-w
fig|553590.4.peg.806 Staphylococcus aureus A9754 FIG   Truncated cell surface protein map-w
fig|553594.3.peg.2481 Staphylococcus aureus A9765 FIG   Truncated cell surface protein map-w
fig|644279.4.peg.2344 Staphylococcus aureus subsp. aureus 132 FIG   Truncated cell surface protein map-w
fig|93061.3.peg.2326 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Truncated cell surface protein map-w
fig|93061.5.peg.2225 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Truncated cell surface protein map-w
fig|93062.19.peg.2142 Staphylococcus aureus subsp. aureus COL FIG   Truncated cell surface protein map-w
fig|93062.4.peg.2225 Staphylococcus aureus subsp. aureus COL FIG   Truncated cell surface protein map-w
gb|AAW37073.1 Staphylococcus aureus subsp. aureus COL     surface protein, putative
gb|ABD22835.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD31486.1 Staphylococcus aureus subsp. aureus NCTC 8325     truncated MHC class II analog protein
gb|ABX30193.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_2200
gb|EEV84396.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEW44733.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1214
gb|EEW47899.1 Staphylococcus aureus D30     hypothetical protein SAD30_0022
gi|150375121 Staphylococcus aureus subsp. aureus str. Newman NCBI   truncated MHC class II analog protein
gi|151222321 Staphylococcus aureus subsp. aureus str. Newman NCBI   truncated MHC class II analog protein
gi|160369222 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_2200
gi|161510413 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_2200
gi|221138911 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_09780
gi|221140190 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_00974
gi|257861594 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258450811 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|259159690 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1214
gi|259163341 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0022
gi|57284979 Staphylococcus aureus subsp. aureus COL NCBI   surface protein, putative
gi|57650793 Staphylococcus aureus subsp. aureus COL NCBI   surface protein, putative
gi|87128321 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87162347 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_2164
gi|87203676 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   truncated MHC class II analog protein
gi|88196118 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   truncated MHC class II analog protein
img|637152961 Staphylococcus aureus aureus COL IMG   surface protein, putative
img|637888808 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637895083 Staphylococcus aureus aureus NCTC 8325 IMG   truncated MHC class II analog protein
img|640796540 Staphylococcus aureus aureus Newman IMG   truncated MHC class II analog protein
img|641310207 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
img|641770927 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_2164 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL2197 Staphylococcus aureus subsp. aureus COL KEGG   surface protein, putative
kegg|sae:NWMN_2109 Staphylococcus aureus subsp. aureus Newman KEGG   truncated MHC class II analog protein
kegg|sao:SAOUHSC_02466 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   truncated MHC class II analog protein
kegg|sax:USA300HOU_2200 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|YP_001333143.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   truncated MHC class II analog protein
ref|YP_001576072.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_2200
ref|YP_187008.1 Staphylococcus aureus subsp. aureus COL RefSeq   surface protein, putative
ref|YP_494800.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_2164
ref|YP_500934.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   truncated MHC class II analog protein
ref|ZP_03563712.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_09780
ref|ZP_03564683.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_00974
ref|ZP_05698870.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QJ49 Staphylococcus aureus (strain Newman) TrEMBL   Truncated MHC class II analog protein
tr|A8Z316 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|Q2FES8 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2FW51 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Truncated MHC class II analog protein
tr|Q5HDZ9 Staphylococcus aureus (strain COL) TrEMBL   Surface protein, putative


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search