The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.2141: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: putative transport system permease protein
Translate Function Assignments



Context on contig NC_007793 from base 2150067 to 2161701 (11635 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2136 2151026 2150067 960 -       3: 1 5 2   Fructokinase (EC 2.7.1.4) locus|SAUSA300_1993, protein_id|YP_494644.1, gi|87162151, geneID|3914698
2137 2152507 2151023 1485 - -4     3: 3 1 2   Sucrose-6-phosphate hydrolase (EC 3.2.1.B3) gene_name|scrB, locus|SAUSA300_1994, protein_id|YP_494645.1, gi|87162074, geneID|3914253
2138 2153606 2152656 951 - 148     2: 1 2   Sucrose operon repressor ScrR, LacI family gene_name|scrR, locus|SAUSA300_1995, protein_id|YP_494646.1, gi|87161098, geneID|3914304
2139 2155039 2153789 1251 - 182         Ammonium transporter family gene_name|amt, locus|SAUSA300_1996, protein_id|YP_494647.1, gi|87161683, geneID|3914448
2140 2155471 2155247 225 - 207         Hypothetical protein SAV2044 locus|SAUSA300_1997, protein_id|YP_494648.1, gi|87161883, geneID|3914394
2141 2156610 2155531 1080 - 59         putative transport system permease protein locus|SAUSA300_1998, protein_id|YP_494649.1, gi|87160492, geneID|3915082
2142 2157549 2156914 636 - 303     1: 7   Redox-sensing transcriptional repressor Rex gene_name|rex, locus|SAUSA300_1999, protein_id|YP_494650.1, gi|87160767, geneID|3913742
2143 2157802 2159730 1929 + 252     1: 6   ABC transporter ATP-binding protein uup gene_name|vga, locus|SAUSA300_2000, protein_id|YP_494651.1, gi|87161346, geneID|3912863
2144 2160091 2161701 1611 + 360     1: 4   MutS-related protein, family 1 locus|SAUSA300_2001, protein_id|YP_494652.1, gi|87160303, geneID|3914539

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|451515.3.peg.2141 putative transport system permease protein
MWMIFSGLIVGGLLGFVMQRTRFCLTGGFRDMYVQKNNKMFYALLIAITIQSIGLLILTA
TDILQIPAHSFPILGTIIGSFIFGIGIVLAGGCATGTWYRAGEGLIGSWIALVLYAVTAA
ITKTGILKPVMDKINQPTNVNSDMSQTTGIPFWGLVVILTIITIFLVVRTLNNKKVRVAV
PKLKQRYTGIRYYLFEKRYHPFIAAIVIGLIALLAWPMSASTGRNDGLGITTPSANLVHF
LITGETKFIDWGVFLVLGIFIGSYIAARGSREFKWRLPDKITIRNSAIGGICMGFGASVA
GGCSIGNGLVETATMTWQGWIALASMIVGVWTMSHFIFVRPMKKVHQQSAKVKQQTQIV

MD5 = 54075d66e533c29a302637a8521e33b1


  DNA Sequence

>fig|451515.3.peg.2141 putative transport system permease protein
atgtggatgatttttagtggcttaattgtcgggggactcttaggttttgtcatgcaaaga
acaagattttgtttaacaggtggctttcgagatatgtatgtgcaaaagaataataagatg
ttctatgcattattaatcgctattactattcaaagtataggattattgattttgacggca
acagatattttacaaattcctgcacatagttttccaatattgggaacaattataggttct
tttatttttggaattggaatagtattggctggaggatgtgcaacaggtacttggtatcgc
gctggtgaagggctaattggtagttggattgcattagtattatatgctgttactgcagca
atcactaaaacagggattttaaagccagtaatggataaaattaatcaaccaacgaatgta
aatagtgatatgtctcaaacaactggcattccgttttggggattagtcgttatattaact
ataatcaccatttttctagttgtaagaacactcaataataagaaagttcgagttgctgtt
ccaaaactaaagcaacgttatacaggtattagatattaccttttcgaaaaacgataccat
ccatttattgcagcaattgtaattggacttatcgcactcttagcttggccaatgagtgca
tcaactggaagaaatgacggtttaggtataacaacgccttcagcaaatttagtacacttt
ttgattacaggtgaaactaaatttattgattggggtgtctttttagttctaggaattttc
attggttcatatattgcagctagaggatcaagagaatttaaatggcgattgccagacaag
attacaatacgaaacagtgccattggtggcatatgtatgggatttggtgcgtcagttgct
ggtggttgttctatcggtaacggtttggttgaaacggcaacgatgacttggcaaggatgg
attgcgctagcatcgatgatagttggtgtatggacaatgagtcattttatctttgttcgt
ccaatgaaaaaagtacaccaacaatctgcaaaggttaaacagcaaacgcaaatagtatag


  DNA with Flanking Sequence

>fig|451515.3.peg.2141 putative transport system permease protein
tagatgttgtgattctaactacaccagaaagagttgcacagaaagttgcagatgaactcg
tccaagctggtgtgaaaggtattttaaacttcactcctggtagaattaatacgccttcag
atgtgcaagtacatcaaattgacttaggtatagaattacagtcattattattctttatga
aaaattacagtgaataaatgtgatgttagctttgaatgattaaccttgttatatctttaa
ttaattatagaacagtctgggactaagtatgtctcaggctttttctgttatgtttgaaaa
tgaaaggaaaaactgttgtgttgataaatatagtataggttaataaattaacacgtagag
atataatgatgaatcgtaattaatcgccttccttatatgaatataatataaatatcaaaa
atattgtgtataaggttgaaaacaagaaaatcatcacctataatacatactaaacttatc
ggaaatgagaggttaagattatgtggatgatttttagtggcttaattgtcgggggactct
taggttttgtcatgcaaagaacaagattttgtttaacaggtggctttcgagatatgtatg
tgcaaaagaataataagatgttctatgcattattaatcgctattactattcaaagtatag
gattattgattttgacggcaacagatattttacaaattcctgcacatagttttccaatat
tgggaacaattataggttcttttatttttggaattggaatagtattggctggaggatgtg
caacaggtacttggtatcgcgctggtgaagggctaattggtagttggattgcattagtat
tatatgctgttactgcagcaatcactaaaacagggattttaaagccagtaatggataaaa
ttaatcaaccaacgaatgtaaatagtgatatgtctcaaacaactggcattccgttttggg
gattagtcgttatattaactataatcaccatttttctagttgtaagaacactcaataata
agaaagttcgagttgctgttccaaaactaaagcaacgttatacaggtattagatattacc
ttttcgaaaaacgataccatccatttattgcagcaattgtaattggacttatcgcactct
tagcttggccaatgagtgcatcaactggaagaaatgacggtttaggtataacaacgcctt
cagcaaatttagtacactttttgattacaggtgaaactaaatttattgattggggtgtct
ttttagttctaggaattttcattggttcatatattgcagctagaggatcaagagaattta
aatggcgattgccagacaagattacaatacgaaacagtgccattggtggcatatgtatgg
gatttggtgcgtcagttgctggtggttgttctatcggtaacggtttggttgaaacggcaa
cgatgacttggcaaggatggattgcgctagcatcgatgatagttggtgtatggacaatga
gtcattttatctttgttcgtccaatgaaaaaagtacaccaacaatctgcaaaggttaaac
agcaaacgcaaatagtatagaagattattatgcaaatgatgttgatcaaataaaagtgat
tggaaaaggagaaataattatgatacacgaattaggtacagtaggaatggtatgtccatt
tccgttaattgaagcgcaaaagaaaatggcaacattgcaatctggagatgaattaaaaat
tgattttgattgcacgcaagcgacggaagccattccaaattgggctgcagaaaatggtta
tcctgtaacaaactatgaacaaattgataatgcttcatggacaattacaattcaaaaagt
ttaacgttatcattttaacaataaaatagatattagattctatggctacttccgctaatt
taaaagtgagtaagtagtcttttttgttttagttcatgaaatcatttttatatagtgtgg
cacattttattccaaaagatgtaataaaacttaacgcatttttgctttttataaattgtc
agattattatgaaaaaaagggagtggtaagtatgaatctt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA2048 Staphylococcus aureus NCTC 8325     inner membrane protein YeeE
cmr|SACOL2034 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_1998 Staphylococcus aureus subsp. aureus USA300-FPR3757     putative membrane protein
dbj|BAF68224.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.171 Staphylococcus aureus subsp. aureus USA300 FIG   putative transport system permease protein
fig|426430.6.peg.1899 Staphylococcus aureus subsp. aureus str. Newman FIG   putative transport system permease protein
fig|426430.8.peg.2137 Staphylococcus aureus subsp. aureus str. Newman FIG   putative transport system permease protein
fig|451516.9.peg.2130 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   putative transport system permease protein
fig|452948.4.peg.1977 Staphylococcus aureus 930918-3 FIG   putative transport system permease protein
fig|455227.3.peg.2122 Staphylococcus aureus D30 FIG   putative transport system permease protein
fig|546342.3.peg.352 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   putative transport system permease protein
fig|546343.3.peg.276 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   putative transport system permease protein
fig|553594.3.peg.2007 Staphylococcus aureus A9765 FIG   putative transport system permease protein
fig|644279.4.peg.2189 Staphylococcus aureus subsp. aureus 132 FIG   putative transport system permease protein
fig|93061.5.peg.2063 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   putative transport system permease protein
fig|93062.19.peg.1984 Staphylococcus aureus subsp. aureus COL FIG   putative transport system permease protein
fig|93062.4.peg.1994 Staphylococcus aureus subsp. aureus COL FIG   putative transport system permease protein
gb|AAW36997.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD20980.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     putative membrane protein
gb|ABX30039.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical membrane protein
gb|EEV82820.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEW44411.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1765
gb|EEW46464.1 Staphylococcus aureus D30     hypothetical protein SAD30_0424
gi|150374964 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151222164 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_1952
gi|160369068 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical membrane protein
gi|161510259 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_2042
gi|221137364 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_01771
gi|221140269 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_01379
gi|257859982 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258452395 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|259159356 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1765
gi|259161880 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0424
gi|57284903 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57650717 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL2034
gi|87126466 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative membrane protein
gi|87160492 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_1998
img|637152790 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637888643 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|640796369 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641310039 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical membrane protein
img|641771536 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical membrane protein
kegg|saa:SAUSA300_1998 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL2034 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_1952 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sax:USA300HOU_2042 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|YP_001332986.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_1952
ref|YP_001575918.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_2042
ref|YP_186851.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL2034
ref|YP_494649.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_1998
ref|ZP_03562171.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_01771
ref|ZP_03564762.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_01379
ref|ZP_05700405.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QIP2 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8Z4V0 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Hypothetical membrane protein
tr|Q2FF79 Staphylococcus aureus (strain USA300) TrEMBL   Putative membrane protein
tr|Q5HEF6 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search