The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.2066: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: Bacteriophage
Translate Function Assignments



Context on contig NC_007793 from base 2096778 to 2109346 (12569 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2062 2101307 2096778 4530 -       1: 1   Phage tail length tape-measure protein locus|SAUSA300_1930, protein_id|YP_494581.1, gi|87161338, geneID|3915309
2063 2101501 2101364 138 - 56         Bacteriophage locus|SAUSA300_1931, protein_id|YP_494582.1, gi|87160311, geneID|3914547
2064 2101902 2101552 351 - 50         Bacteriophage locus|SAUSA300_1932, protein_id|YP_494583.1, gi|87162203, geneID|3914846
2065 2102092 2101952 141 - 49         Bacteriophage locus|SAUSA300_1933, protein_id|YP_494584.1, gi|87161123, geneID|3914349
2066 2102862 2102218 645 - 125         Bacteriophage locus|SAUSA300_1934, protein_id|YP_494585.1, gi|87159942, geneID|3914989
2067 2103270 2102866 405 - 3         Bacteriophage  
2068 2103671 2103267 405 - -4         Bacteriophage locus|SAUSA300_1935, protein_id|YP_494586.1, gi|87162402, geneID|3913925
2069 2104030 2103668 363 - -4         Phage protein locus|SAUSA300_1936, protein_id|YP_494587.1, gi|87161648, geneID|3913150
2070 2104298 2104014 285 - -17         Phage protein  
2071 2104572 2104288 285 - -11         Phage transcriptional terminator locus|SAUSA300_1937, protein_id|YP_494588.1, gi|87160929, geneID|3914367
2072 2105737 2104592 1146 - 19         Phage major capsid protein # Fam0013 locus|SAUSA300_1938, protein_id|YP_494589.1, gi|87160211, geneID|3913084
2073 2106498 2105761 738 - 23         Phage head, head-tail preconnector protease C locus|SAUSA300_1939, protein_id|YP_494590.1, gi|87162394, geneID|3913917
2074 2107669 2106482 1188 - -17         Phage portal protein locus|SAUSA300_1940, protein_id|YP_494591.1, gi|87161728, geneID|3913014
2075 2109346 2107685 1662 - 15         Phage terminase, large subunit locus|SAUSA300_1941, protein_id|YP_494592.1, gi|87160610, geneID|3913271

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|451515.3.peg.2066 Bacteriophage
MVVKQASAPKAYFNITGLGFAKLTKEGAKLEYSDITKTRGLQKIGVETGGDLKTAYADGG
PIESGNTDGEGKISLQMHAFPKEIRKIVFNEEYDEYGVYKETQGKQNNYVAIWFRQERRD
GTFRTVLLPKVMFTNPKIDGETAEKDWDFSSEEVEGEALFPLIDNKKSVRKYIFDSANMT
NHSGNGEKGEEAFLKKILGEEYTGNVTEDNGETL

MD5 = 944a269806bf906c063402ac7bb3b4f4


  DNA Sequence

>fig|451515.3.peg.2066 Bacteriophage
atggtagtaaaacaagcaagtgcgccgaaagcgtattttaacattactggtttaggtttc
gctaaattaacaaaagaaggcgcaaagctagaatatagcgatattacaaaaactagagga
ttacaaaaaatcggtgttgaaactggaggagacttgaaaacagcatatgctgatggtggt
ccaatcgaatcagggaacacagacggagaaggtaaaatttcgttacaaatgcatgctttc
cctaaagagattcgcaaaatagtattcaatgaagagtatgatgaatacggtgtttataaa
gaaactcaaggtaaacaaaacaactatgtagcaatttggttcagacaagagcgtcgagac
ggcacatttagaacggttttattacctaaagtcatgtttacaaatcctaaaatcgatggc
gaaacggctgagaaagattgggatttctcaagcgaagaggttgaaggtgaggcacttttc
cctttaattgataataaaaagtcagtacgtaaatatatctttgattcagcaaacatgaca
aatcatagtggaaatggtgaaaaaggcgaagaggctttcttaaagaaaattttaggcgaa
gaatatactggaaacgtgacagaggataacggcgaaactttgtaa


  DNA with Flanking Sequence

>fig|451515.3.peg.2066 Bacteriophage
atcaaacctaaagctatgggtggcgttaatagagcaataagacaagggcaaaataagtat
tttgagacgctaaaaagggagttaaaaaaattgtgattgatattttgtacaaagttcatg
aagtgattagtcaagacagaattattagagagcacgtaaatatcaataatattaagttca
ataaatacccaaacgtaaaagatacggatgtacctttcatagttattgacgatatagacg
acccaatacctacaacttatactgacggagatgagcgcgcatatagttacattgtacaaa
tagatgtatttgtgaagtttaacgaaaagtataacgcgagaatcataagaaataagatat
ctaatcgtattcaaaagttattatggtctgaactgaaaatgggaaatgtatccaacggaa
aacctgaatatatagaagaatttaaaacatatagaagcactcgtgtctacgagggcattt
tttacgaggaggaataataaatggtagtaaaacaagcaagtgcgccgaaagcgtatttta
acattactggtttaggtttcgctaaattaacaaaagaaggcgcaaagctagaatatagcg
atattacaaaaactagaggattacaaaaaatcggtgttgaaactggaggagacttgaaaa
cagcatatgctgatggtggtccaatcgaatcagggaacacagacggagaaggtaaaattt
cgttacaaatgcatgctttccctaaagagattcgcaaaatagtattcaatgaagagtatg
atgaatacggtgtttataaagaaactcaaggtaaacaaaacaactatgtagcaatttggt
tcagacaagagcgtcgagacggcacatttagaacggttttattacctaaagtcatgttta
caaatcctaaaatcgatggcgaaacggctgagaaagattgggatttctcaagcgaagagg
ttgaaggtgaggcacttttccctttaattgataataaaaagtcagtacgtaaatatatct
ttgattcagcaaacatgacaaatcatagtggaaatggtgaaaaaggcgaagaggctttct
taaagaaaattttaggcgaagaatatactggaaacgtgacagaggataacggcgaaactt
tgtaacgcaaccggcttcatcggaaactgagataaagtcggttaatataccagatagttt
taaaacactaaaagttggcaacacatatgatttaaatgttgtagtagagccatctaatca
aagtaagttattgaaatacacaacagatcaaacgaatattgtatcaatcaatagtgatgg
tcaagtcactgcggaagcacaaggtattgccacggttaaagcatatgttggtaatatgag
tgacactataacaataaatgtagaagcataagaggggacaacccctctattttatttgaa
aataaggagagtattataaaatggcaaaattaaaacgtaacattattcaattagtagaag
atccaaaagcaaatgaaattaaattacaaacgtacttaacaccacacttcatttcatttg
aaattgtatacgaagcaatggatttaatcgatgatattgaggacgaaaatagcacgatga
agccaagagaaatcgctgacagatt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|SAUSA300_1934 Staphylococcus aureus subsp. aureus USA300-FPR3757     phi77 ORF020-like protein, phage major tail protein
fig|367830.3.peg.2337 Staphylococcus aureus subsp. aureus USA300 FIG   Bacteriophage
fig|451516.9.peg.2056 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Bacteriophage
fig|553590.4.peg.1576 Staphylococcus aureus A9754 FIG   Bacteriophage
gb|ABD20430.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     phi77 ORF020-like protein, phage major tail protein
gb|ABX29961.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical bacteriophage protein
gi|160368990 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical bacteriophage protein
gi|161510181 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1962
gi|87125916 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   phi77 ORF020-like protein, phage major tail protein
gi|87159942 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   phi77 ORF020-like protein, phage major tail protein
img|637888579 Staphylococcus aureus aureus USA300 IMG   phi77 ORF020-like protein, phage major tail protein
img|641309960 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical bacteriophage protein
img|641773292 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical bacteriophage protein
kegg|saa:SAUSA300_1934 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   phi77 ORF020-like protein, phage major tail protein
kegg|sax:USA300HOU_1962 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|YP_001575840.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_1962
ref|YP_494585.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   phi77 ORF020-like protein, phage major tail protein
tr|A8Z2X2 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Hypothetical bacteriophage protein
tr|Q2FFE3 Staphylococcus aureus (strain USA300) TrEMBL   Phi77 ORF020-like protein, phage major tail protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search